KEGG   Cricetulus griseus (Chinese hamster): 100774999
Entry
100774999         CDS       T02813                                 

Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100774999
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cge04030]
    100774999
G protein-coupled receptors [BR:cge04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    100774999
SSDB
Motif
Pfam: 7tm_1 PhoR Cytochrom_B_C
Other DBs
NCBI-GeneID: 100774999
NCBI-ProteinID: XP_027245082
LinkDB
Position
1
AA seq 358 aa
MNASFYRCQASPWVEKGSSATMGGVLFTAGLLGNLLALVLLARSGLGSCRQRPLHPQPSV
FYVLVCGLTVTDFLGKCLISPVVLAAYAQNRSLQELLPAGGNQLCQAFAFIMSFFGLAST
LQLLAMALECWLSLGHPFFYQRHITLRRGVLVAPIVGTFSLAFCALPFTGFGKFVQYCPG
TWCFIQMVHEKRSLSVLGFSVLYSSLMALLVLATVLCNLGAMHNLYTMHRRLRRHPRSCL
RDHPQAGSGHRQESPHPLEELDHLLLLALMTVLFTMCSLPLIYRAYYGAFKLSDTTEGDL
EDLLALRFLSVISIVDPWIFIIFRTSVFRMLFHKIFIRPLVFRNWHSHSYQSKTESTL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgaatgcgtcgttctatcgctgccaggcatccccctgggtggaaaagggctcctcggcg
acgatgggcggcgtgctcttcactgcagggctgctgggcaacctgctggcgctggtgctg
ctggcgcggtcaggcctggggtcctgccggcagcggccgctgcaccctcaaccctctgtc
ttctacgtgctagtgtgtggcttgacagtcaccgactttctgggcaagtgtctaatcagc
ccggtggtcctggctgcctatgcgcaaaaccggagcctacaggaactgctgcctgccggg
ggcaatcaattatgtcaagccttcgccttcattatgtccttctttgggctagcctcgacg
ttacagctgctggctatggcgctggagtgctggctgtctctgggacatcccttcttctac
caaaggcacattaccctgcgcaggggagtactggtggcgcctattgtgggaaccttcagt
ttggctttctgcgcactccccttcactggctttgggaagttcgtacagtactgcccgggc
acctggtgcttcatccagatggtccatgagaagcgctcgctgtcggttctcggcttctct
gtgctctactccagcctcatggcgctgctagtcctcgctaccgtgctctgcaacctgggt
gccatgcacaacctctataccatgcaccggcgcctgaggcgccaccctcgctcctgcctc
agggaccacccccaagcaggctcaggtcataggcaagagtccccgcatcccctggaggag
ctggaccacctcctgctgctggctctgatgacagtgctcttcactatgtgttccctgcct
ttaatttatcgtgcttactatggagcattcaaactttcggacacaactgaaggagacttg
gaagatctcctggccttgcgttttctgtctgtgatttcaatcgtggacccctggattttc
atcattttcaggacttcagtattccggatgttatttcacaagattttcataagacctctg
gtcttcagaaactggcacagccattcctaccaatctaagacggaatccactctgtga

DBGET integrated database retrieval system