KEGG   Cricetulus griseus (Chinese hamster): 103159499
Entry
103159499         CDS       T02813                                 

Gene name
Fosl1
Definition
(RefSeq) fos-related antigen 1
  KO
K04502  fos-like antigen 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04310  Wnt signaling pathway
cge04380  Osteoclast differentiation
cge04657  IL-17 signaling pathway
cge05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103159499 (Fosl1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    103159499 (Fosl1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103159499 (Fosl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103159499 (Fosl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    103159499 (Fosl1)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    103159499 (Fosl1)
SSDB
Motif
Pfam: bZIP_1 bZIP_Maf bZIP_2 DUF3450 Macoilin ASD2 Siah-Interact_N HALZ TMCO5 DUF4407 UPF0242
Other DBs
NCBI-GeneID: 103159499
NCBI-ProteinID: XP_027264407
UniProt: G3I2G1
LinkDB
Position
3
AA seq 279 aa
MYRDFGEPGPSSGAGSAYGRPAQPPQAQAQTAQHQKFHLVPSINAVSGSQELQWMVQPHF
LGPSGYPRPLAYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLA
AAKCRNRRKELTDFLQAETDKLEDEKSSLQREIEELQKQKERLELVLEAHRPICKIPEGD
KDTGGTSSTSGSGARGGGSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPS
LVFTYPSTPEPCSSAHRKSSSSSGDPSSDPLGSPTLLAL
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtaccgagacttcggggaaccgggaccgagctccggggccggcagcgcgtacggtcgc
cccgcgcagcccccgcaggctcaggcgcagaccgcccagcatcagaagttccaccttgtg
ccaagcatcaatgctgtgagtggcagccaggaattgcagtggatggtgcagcctcatttc
ctgggacccagtggctatccccgacctctggcctatccccagtacagtccccctcagccc
cggccaggagtcatacgagccctagggccacctccaggggtgcgtcgtaggccctgtgag
cagatcagcccagaggaggaagagcgccgcagagtgaggcgtgaaaggaacaagttagca
gcagctaagtgcagaaaccgaagaaaggaactgacagacttcctgcaggcggagaccgac
aaattggaggacgagaaatcgagcctgcagcgagagattgaagagctgcagaaacagaag
gagcgccttgagctggtgttggaagcccatcgccccatctgcaaaatcccagaaggagat
aaggacacaggtggtaccagcagcaccagcggctctggcgcccgtggcggcggcagccca
ccagccccctgccgcccggtaccttgtatctccctttctccagggcctgtacttgaacct
gaagccctgcacacccccacgctcatgaccacaccgtctctgactccctttactcccagt
ctggttttcacctaccctagcacaccagaaccttgttcctcagcacatcgaaagagtagc
agcagcagtggcgacccctcctccgaccccctgggttctcccacactcctggctttgtga

DBGET integrated database retrieval system