KEGG   Cricetulus griseus (Chinese hamster): 103160601
Entry
103160601         CDS       T02813                                 

Gene name
Cdkn1a
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X2
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04012  ErbB signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04115  p53 signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04218  Cellular senescence
cge04630  JAK-STAT signaling pathway
cge04921  Oxytocin signaling pathway
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05217  Basal cell carcinoma
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103160601 (Cdkn1a)
   04630 JAK-STAT signaling pathway
    103160601 (Cdkn1a)
   04066 HIF-1 signaling pathway
    103160601 (Cdkn1a)
   04068 FoxO signaling pathway
    103160601 (Cdkn1a)
   04151 PI3K-Akt signaling pathway
    103160601 (Cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103160601 (Cdkn1a)
   04115 p53 signaling pathway
    103160601 (Cdkn1a)
   04218 Cellular senescence
    103160601 (Cdkn1a)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103160601 (Cdkn1a)
   04928 Parathyroid hormone synthesis, secretion and action
    103160601 (Cdkn1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103160601 (Cdkn1a)
   05202 Transcriptional misregulation in cancer
    103160601 (Cdkn1a)
   05206 MicroRNAs in cancer
    103160601 (Cdkn1a)
   05205 Proteoglycans in cancer
    103160601 (Cdkn1a)
   05203 Viral carcinogenesis
    103160601 (Cdkn1a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103160601 (Cdkn1a)
   05212 Pancreatic cancer
    103160601 (Cdkn1a)
   05225 Hepatocellular carcinoma
    103160601 (Cdkn1a)
   05226 Gastric cancer
    103160601 (Cdkn1a)
   05214 Glioma
    103160601 (Cdkn1a)
   05216 Thyroid cancer
    103160601 (Cdkn1a)
   05220 Chronic myeloid leukemia
    103160601 (Cdkn1a)
   05217 Basal cell carcinoma
    103160601 (Cdkn1a)
   05218 Melanoma
    103160601 (Cdkn1a)
   05211 Renal cell carcinoma
    103160601 (Cdkn1a)
   05219 Bladder cancer
    103160601 (Cdkn1a)
   05215 Prostate cancer
    103160601 (Cdkn1a)
   05213 Endometrial cancer
    103160601 (Cdkn1a)
   05224 Breast cancer
    103160601 (Cdkn1a)
   05222 Small cell lung cancer
    103160601 (Cdkn1a)
   05223 Non-small cell lung cancer
    103160601 (Cdkn1a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103160601 (Cdkn1a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103160601 (Cdkn1a)
   05161 Hepatitis B
    103160601 (Cdkn1a)
   05160 Hepatitis C
    103160601 (Cdkn1a)
   05163 Human cytomegalovirus infection
    103160601 (Cdkn1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103160601 (Cdkn1a)
   05169 Epstein-Barr virus infection
    103160601 (Cdkn1a)
   05165 Human papillomavirus infection
    103160601 (Cdkn1a)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103160601 (Cdkn1a)
   01522 Endocrine resistance
    103160601 (Cdkn1a)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103160601
NCBI-ProteinID: XP_027250250
LinkDB
Position
1
AA seq 163 aa
MSGPDDVRPVPHRSKVCRRLFGPVDSEQLSRDCDALMAGCLQEARERWNFDFVTETPLEG
NYVWERVWDLGLPKLYLSPGSRGGRDDLGGDKRPSTSSALLQGSAPDDHVALSLSCTLVS
HGPERPEDTPGGPGTSQGRKRRQTSLTDFYHSKRRLVFCKRKP
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtcgggtcccgatgacgtccgacccgtgccacacaggagcaaggtgtgccgccgtctc
ttcggtcccgtggacagtgagcagttgagccgcgattgtgatgcgctcatggccggctgc
ctccaggaggcccgagaacggtggaacttcgacttcgtcaccgagacgccgctggagggc
aactatgtttgggagcgcgtttgggacctagggctgcccaagctctacctgagccctggg
tcccgcggtggccgtgacgacctgggaggggacaagcggcccagcacctcctctgccttg
ctgcaggggtcagcccccgacgaccatgtggccctgtcgctgtcctgcactctggtgtct
cacggccctgagcggcctgaggacacccccggtggacccggaacctctcagggtcgcaaa
cggaggcagacgagcctgacagatttctatcattctaagcgccggctggtcttttgcaag
aggaagccctaa

DBGET integrated database retrieval system