KEGG   Cricetulus griseus (Chinese hamster): 113830648Help
Entry
113830648         CDS       T02813                                 

Gene name
Gale
Definition
(RefSeq) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00520  Amino sugar and nucleotide sugar metabolism
cge01100  Metabolic pathways
Module
cge_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    113830648 (Gale)
   00520 Amino sugar and nucleotide sugar metabolism
    113830648 (Gale)
Enzymes [BR:cge01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     113830648 (Gale)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 KR NAD_binding_4 NAD_binding_10 adh_short NmrA
Motif
Other DBs
NCBI-GeneID: 113830648
NCBI-ProteinID: XP_027255516
UniProt: G3HMV4
LinkDB All DBs
Position
2
AA seq 348 aa AA seqDB search
MAEKVLVTGGAGYIGSHTVLELLEAGYAPVVIDNFHNAIRGGDSMPESLRRVQELTGRSV
EFEEMDILDQAALQHLFKKHSFKAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMR
AHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMVRDLCRADSAWNA
VLLRYFNPTGAHASGRIGEDPQGVPNNLMPYVSQVAIGRREALNVFGGDYDTEDGTGVRD
YIHVVDLAKGHIAALKKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARR
EGDVAACYANPSLAHEELGWTAALGLDRMCEDLWRWQKQNPSGFGAQA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaaggtgctggtcacaggcggagctggctacattggcagccacacggtactg
gagctgctggaggcaggctacgcccctgtggtcatcgacaacttccataatgccattcgt
ggaggggattccatgcctgagagcctgcggcgggtccaggaactgacaggccgctctgtg
gagtttgaggagatggacatcttggaccaggcagcgctacagcacctctttaagaagcac
agctttaaggctgtcatccactttgctgggctcaaggctgtgggcgagtcggtgcagaag
cctctggattattatagagttaacctaacagggaccatccagcttctggagatcatgagg
gcccacggggtgaagaatctcgtgttcagcagctcagccaccgtgtatgggaatccccag
tacctgcctctggatgaggcccaccccaccgggggttgtaccaacccctatggaaagtcc
aagttcttcatcgaggagatggtccgggacctgtgccgggcagattcggcctggaacgca
gtgctgctacgctacttcaatcccacgggtgcccacgcctctggccgcatcggcgaggat
ccccagggcgtccccaacaacctcatgccctatgtctcccaggtggcaattgggcgacga
gaggccctgaatgtctttggtggtgactatgatacagaggatggcacaggtgtaagggat
tacattcatgtggtggatctggcgaagggccacatcgcagccttgaagaagctgaaggag
caatgtggttgccggatctacaacctgggcacaggcacaggctactctgtcctgcagatg
gtccaagcaatggagaaggcttcagggaagaagatcccatacaaggtggtggcacggcgg
gaaggtgacgtggcagcctgttatgccaaccccagcctggcccatgaggagctgggctgg
acagcagccttggggctggacaggatgtgtgaagatctatggcgctggcagaagcagaac
ccttcaggctttggagcacaggcctaa

DBGET integrated database retrieval system