KEGG   Cricetulus griseus (Chinese hamster): 113835797Help
Entry
113835797         CDS       T02813                                 

Definition
(RefSeq) protein TCL1B2-like
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    113835797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TCL1_MTCP1
Motif
Other DBs
NCBI-GeneID: 113835797
NCBI-ProteinID: XP_027272274
LinkDB All DBs
Position
5
AA seq 130 aa AA seqDB search
MAALPLRPPPFCLTWISPGYYRDEKQKFWMVEKQEFHPCHPPYNRLKDSITIRMLQVSRL
PPEATFPSELHLICLPKTWQQHSLTSYWCTNLRIWKLVDHIQIGDREYLVLTLDFRAGLQ
SISPFCSAQS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcttcccctgcgaccaccaccattctgtcttacttggatcagtcccggttac
tacagggacgagaagcagaaattctggatggttgaaaagcaggaatttcatccctgccat
ccaccttataacaggcttaaagactctatcaccatcagaatgttgcaggtgagcagattg
cccccggaggccacttttccctctgagttgcatttgatctgtctccccaagacatggcag
cagcattctctgacatcatactggtgcacaaacttaaggatctggaaattagtggaccat
atccagattggtgacagagaatacctggtccttacactggacttcagggctggtctccag
tctatcagtcccttctgctcagctcagtcctga

DBGET integrated database retrieval system