KEGG   Cricetulus griseus (Chinese hamster): 113838537
Entry
113838537         CDS       T02813                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha-like
  KO
K04737  interleukin 3 receptor alpha
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04060  Cytokine-cytokine receptor interaction
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04630  JAK-STAT signaling pathway
cge04640  Hematopoietic cell lineage
cge05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    113838537
   04151 PI3K-Akt signaling pathway
    113838537
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113838537
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113838537
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113838537
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838537
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cge04050]
    113838537
   04090 CD molecules [BR:cge04090]
    113838537
Cytokine receptors [BR:cge04050]
 Interleukin receptor families
  IL3 receptor family
   113838537
CD molecules [BR:cge04090]
 Proteins
  113838537
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind GPHH
Other DBs
NCBI-GeneID: 113838537
NCBI-ProteinID: XP_035309643
LinkDB
Position
Unknown
AA seq 405 aa
MAAALCLLLALATPTAGLVTSETGPAPPFRSLRLEPRERRLSWELSGDVRNIACSKEGRS
PVWPEPGGRSCLFPSLSLCHVTKFTVFNDDDPEVNAWILFPESDPNRAAAATDVQCSLHH
VDRISCRWGRGRGAPSDVQYRMFWRDAGQGRERDRECQLYDVTDEGGAHLGCTVNAAGVA
LPVQVAVTVTGSSAREEISCSDVIVDLQGAEVLAPPTVRAECNGSDSALLSWEMRSRFHF
RFAYEVEMTQVGRPGDTGNRARESQAWAGPPGRGRGQRNYVTGPIPPQTTESHFRFRIPG
SASFRVRARPFDVTAYSAWSEAVRLDCSPGGRSHVTLMVAVLVAVGAGLTALATMLLLCR
RRLLRKLFPPIPSMKDPMAERAEPAELVTWEATPEDPEVTQVTEA
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggccgccgccctctgtctgctgctggcgctggccacgcccaccgccggcctggtgacg
tcagagacgggccccgccccgcccttccgcagcctccgcttggagccccgggagcgacgc
ctgagctgggagctgagcggtgacgtcagaaacatcgcctgcagcaaggaggggcggagc
cccgtgtggccggagcccggcggccgctcctgcctcttcccgtcgctgtccctgtgtcac
gtgaccaagttcaccgtcttcaacgacgacgacccggaagtgaacgcgtggatcctgttc
ccggagtcagaccccaaccgcgccgccgcggccaccgacgtgcaatgctcgctgcaccac
gtggaccggatttcctgccgctgggggcggggccgcggggcgccgagcgacgtgcagtac
cggatgttctggagggacgcggggcaggggcgggaacgggaccgcgagtgtcagctctac
gacgtcactgacgagggcggggcccacctgggctgcacagtgaacgcggcgggcgtggca
cttcctgtgcaggtggcggtgacggtgaccgggagcagcgcccgggaggaaatttcctgc
agtgacgtcatagtcgacctgcagggggcggaggtcctggccccgcccaccgtgcgcgcc
gagtgcaacggcagcgactccgccctgctgagctgggagatgcggagccgcttccacttc
cggttcgcgtacgaggtggagatgacgcaggtgggacgcccaggcgacaccggaaaccga
gcgcgtgagtcccaggcctgggcggggcctcccgggagggggcggggtcagcgcaattac
gtcacggggccaatccccccgcagaccaccgagagccacttccgcttccgcatccctggc
tccgcctccttccgggtcagggcgcggccgttcgacgtcactgcctacagcgcctggagc
gaggccgtgaggctggactgtagccccggtgggcggagccacgtgacgctgatggtcgcc
gtgctggtggcggtcggggcggggctaacggcgctggcgacgatgctgctgctgtgtcgg
aggcggctgctccggaagctgttcccgcccatccccagcatgaaggacccgatggcggag
agggcggagcctgcagagctggtcacgtgggaggcgacgcccgaggaccccgaggtgaca
caggtgacggaggcctga

DBGET integrated database retrieval system