Cricetulus griseus (Chinese hamster): 3979178 Help Entry 3979178           CDS       T02813                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge00190   Oxidative phosphorylation cge01100   Metabolic pathways cge04714   Thermogenesis cge04723   Retrograde endocannabinoid signaling cge05010   Alzheimer disease cge05012   Parkinson disease cge05014   Amyotrophic lateral sclerosis cge05016   Huntington disease cge05020   Prion disease cge05022   Pathways of neurodegeneration - multiple diseases cge05208   Chemical carcinogenesis - reactive oxygen species cge05415   Diabetic cardiomyopathy Module cge_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:cge00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     3979178 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     3979178 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     3979178 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     3979178 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     3979178 (ND4L)    05012 Parkinson disease     3979178 (ND4L)    05014 Amyotrophic lateral sclerosis     3979178 (ND4L)    05016 Huntington disease     3979178 (ND4L)    05020 Prion disease     3979178 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     3979178 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     3979178 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cge03029]     3979178 (ND4L) Enzymes [BR:cge01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      3979178 (ND4L) Mitochondrial biogenesis [BR:cge03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     3979178 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 60KD_IMP Motif Other DBs NCBI-GeneID:  3979178 NCBI-ProteinID:  YP_537127 UniProt:  Q27PP7 LinkDB All DBs Position MT Genome browser AA seq 98 aa AA seqDB search MTTTVLNIVLAYIFSLLGTVLFRSHLMSTLLCLEGMMLSLFIMTAMTSLNTHSMGMYSNP IVILVFAACEAAVGLALLVVVSNTYGTDYVKNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacaaccacagtccttaatattgtattagcttacattttttcacttctcgggactgtg ctatttcgatctcacctaatgtctacgcttctatgtttagaaggtataatactctctcta tttatcataacagcaataacctcacttaacacacattcgataggtatgtattcaaatcct atcgtaattctggtgtttgcagcatgcgaagccgcagtaggcttggccctacttgtagta gtgtcaaacacttacggaacagactatgtaaaaaacctcaacctcctacaatgttaa

DBGET integrated database retrieval system