KEGG   Corynebacterium glutamicum SCgG2: C629_02225Help
Entry
C629_02225        CDS       T02691                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
cgg00020  Citrate cycle (TCA cycle)
cgg00190  Oxidative phosphorylation
cgg00650  Butanoate metabolism
cgg01100  Metabolic pathways
cgg01110  Biosynthesis of secondary metabolites
cgg01120  Microbial metabolism in diverse environments
cgg01130  Biosynthesis of antibiotics
cgg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C629_02225 (sdhA)
   00650 Butanoate metabolism
    C629_02225 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C629_02225 (sdhA)
Enzymes [BR:cgg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C629_02225 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     C629_02225 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C NAD_binding_8 GIDA AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AGN21057
LinkDB All DBs
Position
481685..483706
Genome map
AA seq 673 aa AA seqDB search
MSTHSETTRPEFIHPVSVLPEVSAGTVLDAAEPAGVPTKDMWEYQKDHMNLVSPLNRRKF
RVLVVGTGLSGGAAAAALGELGYDVKAFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGAY
RHVKDTVKGGDYRGRESDCWRLAVESVRVIDHMNAIGAPFAREYGGALATRSFGGVQVSR
TYYTRGQTGQQLQLSTASALQRQIHLGSVEIFTHNEMVDVIVTERNGEKRCEGLIMRNLI
TGELTAHTGHAVILATGGYGNVYHMSTLAKNSNASAIMRAYEAGAYFASPSFIQFHPTGL
PVNSTWQSKTILMSESLRNDGRIWSPKEPNDNRDPNTIPEDERDYFLERRYPAFGNLVPR
DVASRAISQQINAGLGVGPLNNAAYLDFRDATERLGQDTIRERYSNLFTMYEEAIGEDPY
SSPMRIAPTCHFTMGGLWTDFNEMTSLPGLFCAGEASWTYHGANRLGANSLLSASVDGWF
TLPFTVPNYLGPLLGAERLAEDAPEAQAAIERAQARIDRLMGNRPEWVGDNVHGPEYYHR
QLGDILYFSCGVSRNVKDLQDGIDKIRALREDFWKNMRITGSTDEMNQVLEYAARVADYI
DLGELMCVDALDRDESCGAHFRDDHLSEDGEAERDDENWCFVSAWEPGANGTFVRHAEPL
FFESVPLQTRNYK
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcactctgaaaccacccgcccagagttcatccacccagtctccgtcctccca
gaggtctcagctggtacggtccttgacgctgcagagccagctggtgttcccaccaaagac
atgtgggaataccaaaaagaccacatgaacctggtctccccactgaaccgacgcaagttc
cgcgtcctcgtcgtcggcaccggcctgtccggtggcgctgcagcagcagcacttggcgaa
ctcggatatgacgttaaggcgttcacctaccacgacgcacctcgccgtgcgcactccatt
gctgcacagggtggcgtgaactccgcccgcggcaagaaggtagacaacgacggcgcatac
cgccacgtcaaggacaccgtcaagggcggcgactaccgtggccgcgagtccgactgctgg
cgcctcgccgtcgagtccgtccgcgtcatcgaccacatgaacgccatcggtgcaccattc
gcccgcgaatacggtggagccttggcaacccgttccttcggtggtgtgcaggtctcccgt
acctactacacccgtggacaaaccggacagcagctgcagctctccaccgcatccgcacta
cagcgccagatccacctcggctccgtagagatcttcacccataacgaaatggttgacgtc
attgtcaccgaacgtaatggtgaaaagcgctgcgaaggcctgatcatgcgcaacctgatc
accggcgagctcaccgcacacaccggccatgccgttatcttggcaaccggtggctacggc
aacgtgtaccacatgtccaccctggccaagaactccaacgcctcggccatcatgcgtgca
tacgaagccggcgcatacttcgcgtccccatcgttcatccagttccacccaaccggcctg
cctgtgaactccacctggcagtccaagaccattctgatgtccgagtcgctgcgtaacgac
ggccgcatctggtcccctaaggaaccgaacgataaccgcgatccaaacaccatccctgag
gatgagcgcgactacttcctggagcgccgctacccagcattcggtaacctcgtcccacgt
gacgttgcttcccgtgcgatctcccagcagatcaacgctggtctcggtgttggacctctg
aacaacgctgcatacctggacttccgcgacgccaccgagcgcctcggacaggacaccatc
cgcgagcgttactccaacctcttcaccatgtacgaagaggccattggcgaggacccatac
tccagcccaatgcgtattgcaccgacttgccacttcaccatgggcggcctctggactgac
ttcaacgaaatgacgtcactcccaggtctgttctgcgcaggcgaagcatcctggacctac
cacggtgcaaaccgtctgggtgcaaactccctgctctccgcttccgtcgatggctggttc
accctgccattcaccgtccctaactacctcggcccattgcttggcgccgagcgtctggca
gaggatgcaccagaagcgcaggctgcgattgagcgtgcacaggctcgcatcgaccgcctc
atgggcaaccgcccagagtgggtcggtgacaacgttcacggacctgagtactaccaccgc
cagctcggtgacatcctgtacttctcctgtggcgtttctcgaaacgtaaaggacctccag
gacggtatcgacaagatccgtgcgctccgcgaggacttctggaagaacatgcgcatcacc
ggcagcaccgatgagatgaaccaggttctcgaatacgcagcacgcgtagccgactacatc
gacctcggcgaactcatgtgcgtcgacgccctcgaccgcgacgagtcctgtggcgcccac
ttccgcgacgaccacctctccgaagatggcgaagcagaacgtgacgacgaaaactggtgc
ttcgtctccgcatgggaaccaggcgcgaacggaaccttcgtccgccacgcagaaccactg
ttcttcgaatccgtcccactgcagacaaggaactacaagtaa

DBGET integrated database retrieval system