KEGG   Corynebacterium glutamicum SCgG2: C629_02970Help
Entry
C629_02970        CDS       T02691                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
cgg00250  Alanine, aspartate and glutamate metabolism
cgg00280  Valine, leucine and isoleucine degradation
cgg00410  beta-Alanine metabolism
cgg00640  Propanoate metabolism
cgg00650  Butanoate metabolism
cgg01100  Metabolic pathways
cgg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C629_02970
   00650 Butanoate metabolism
    C629_02970
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C629_02970
   00280 Valine, leucine and isoleucine degradation
    C629_02970
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C629_02970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cgg01007]
    C629_02970
Enzymes [BR:cgg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C629_02970
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     C629_02970
Amino acid related enzymes [BR:cgg01007]
 Aminotransferase (transaminase)
  Class III
   C629_02970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 DUF1522
Motif
Other DBs
NCBI-ProteinID: AGN21204
LinkDB All DBs
Position
629038..630384
Genome map
AA seq 448 aa AA seqDB search
MEDLSYRIPQSRTVAEQVPGPKSKALDERRQAAVARALAPGLPGYVVDADGGILADADGN
RFIDLASGIAVTTVGGSNAAVAKAVGAAAARFTHTCFMVSPYETYVAMAERLNALTPGDH
DKKSALFNSGAEAVENAVKVARAYTGKGAVVVFDNAYHGRTNLTMAMTAKNRPYKSGFGP
LAADVYRAPMSYPLRDGLSGPEAAERAISVIESQVGAENLACVVIEPIQGEGGFIVPAPG
FLAAISTWCRENDVVFIADEIQSGFLRTGDWFASDAEGVIPDVITTAKGIAGGMPLSAVT
GRAEIMDAPGPGALGGTYGGNPVACAAALAAIEVMEQADLKTRAQEIEAIIRDEFAQLSA
FPEVAEIRGRGAMMAIELIDATGRPNAALTAAVAARAKAEGVLLLTCGTDGNVIRLLPPL
VIAEDTLRDGLQVLVAALERETAHQKVG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatctctcataccgcatcccgcaatcgcgcaccgtggccgagcaggtgccaggg
ccgaagtcgaaagcgctggatgagcgtcgacaagcagcagtagcacgagcacttgcaccg
ggtctgcctggatacgtggtggacgcagacggtggcatcttggctgacgcggacggcaac
cgtttcatcgacctggcctccggcatcgccgtgaccacggtcggcggatccaacgcggcc
gtcgcgaaagccgtcggcgccgcagctgcccgcttcacccacacctgcttcatggtctca
ccttatgaaacttacgtggcaatggcggagagactcaacgccttgactccaggcgatcac
gacaagaagagcgcgctgtttaactctggcgccgaagccgtggaaaacgccgtcaaggtg
gcacgcgcctacaccggcaagggcgcggtcgtggtgttcgacaacgcgtaccacggacgg
accaacctcaccatggcgatgaccgcgaagaaccgcccatacaagtccggattcggacca
ctagccgcagacgtctaccgtgcaccaatgtcttacccactgcgcgacggactgtccggc
ccggaagccgcagagcgcgcgatctccgtgatcgaatcccaggtcggagccgaaaacctc
gcctgcgtggtcattgaaccgatccagggcgaaggcggattcatcgtccccgcaccagga
ttcctcgcagccatttccacctggtgccgcgagaacgacgtggtgttcatcgccgatgaa
atccaatctggcttcctgcgcaccggcgactggttcgccagcgacgcagaaggtgtgatc
cccgacgtcatcaccaccgcaaaaggcatcgccggcggcatgccactatccgcagtgacc
ggccgcgcagaaatcatggacgcacccggccccggcgcgctcggcggaacctacggcgga
aaccccgttgcttgcgccgcagcacttgcagccattgaagtgatggaacaagccgacctt
aagacccgcgctcaagaaatcgaggccatcatccgcgatgaattcgcgcagctgagtgcc
ttcccggaggtcgccgaaatccgcggccgcggagcaatgatggctattgagcttatcgac
gctaccggccgcccgaacgcagctttaaccgccgcagtggctgcgcgcgcaaaagctgaa
ggtgtgctgctgctgacttgcggcaccgatggcaacgtcatccgcctgctgccaccactg
gtcattgcagaggacactctccgtgatggtcttcaggtgttagtcgcagccctagagcgc
gaaaccgcgcaccagaaggtgggctaa

DBGET integrated database retrieval system