KEGG   Corynebacterium glutamicum SCgG2: C629_03060Help
Entry
C629_03060        CDS       T02691                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cgg  Corynebacterium glutamicum SCgG2
Brite
Translation factors [BR:cgg03012]
 Eukaryotic Type
  Elongation factors
   C629_03060
 Prokaryotic Type
   C629_03060
Mitochondrial biogenesis [BR:cgg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    C629_03060
Exosome [BR:cgg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   C629_03060
  Exosomal proteins of breast cancer cells
   C629_03060
  Exosomal proteins of colorectal cancer cells
   C629_03060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AGN21222
LinkDB All DBs
Position
653834..655024
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPELNEAFAFDSIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVEDEEIIELVEMEVRELLAEQDYDEEAPIVHISALKAL
EGDEKWGKQILELMQACDDNIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGTLNV
NDDVDIIGIKEKSTSTTVTGIEMFRKLLDSAEAGDNCGLLLRGIKREDVERGQVIVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtaccaagccccacgtaaacatcggcaccatcggtcac
gttgaccacggtaagaccaccaccaccgcggctatcaccaaggttctggctgacgcttac
cctgagctcaacgaggctttcgccttcgactccatcgataaggctcctgaggagaaggag
cgtggcatcacgatcaacatctcccacgttgagtaccagaccgagaagcgccactacgca
cacgttgacgctccaggccacgccgactacatcaagaacatgattaccggcgctgctcag
atggacggcgcaatcctcgttgttgctgctaccgacggcccaatgcctcagacccgtgag
cacgttcttcttgctcgccaggttggcgttccttacatcctcgttgctcttaacaagtgc
gacatggttgaggatgaggaaatcatcgagctcgtcgagatggaagttcgtgaacttctt
gctgagcaggactacgacgaagaggctccaattgttcacatctccgctctgaaggctctt
gagggcgacgagaagtggggcaagcagatccttgagctcatgcaggcttgcgatgacaac
atccctgacccagttcgtgaaaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggtcgtggcaccgttgttaccggtcgtgttgagcgcggtaccctgaacgtg
aacgatgatgttgacatcatcggcatcaaggagaagtccacctccaccaccgttaccggt
atcgagatgttccgtaagcttcttgactccgctgaggctggcgacaactgtggtctgctt
ctccgtggtatcaagcgcgaagatgttgagcgtggccaggttatcgttaagccaggcgct
tacacccctcacaccgagttcgagggctctgtctacgttctgtccaaggatgaaggtggc
cgccacaccccattcttcgacaactaccgtcctcagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttccagagggcaccgagatggtcatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgagggcctgcgtttcgctatccgc
gaaggctcccgcaccgttggcgctggtcgtgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system