KEGG   Corynebacterium glutamicum SCgG2: C629_08565Help
Entry
C629_08565        CDS       T02691                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
cgg00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cgg00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    C629_08565
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    C629_08565
Enzymes [BR:cgg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     C629_08565
Bacterial toxins [BR:cgg02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   C629_08565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 NPCBM_assoc BNR DUF11 Big_3_5 Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: AGN22311
LinkDB All DBs
Position
complement(1834460..1837219)
Genome map
AA seq 919 aa AA seqDB search
MGLPFKKAGPLSRRKAVFSALGAAALIGAALPTIPTAQAQTPTGYGFDATASIGEEPEFS
TQQLADGGTLGFDCYRIPSLGVAPNGNVLASWDGRPNNCSDAPQPNSIVGKVSTDNGATW
GEQHDISAGITAEPKTGYSDPSIVVDWERGDVFNFHVKSFDAGYFTSQPGTDPDDRNVAH
VAYAKSSDNGSTWVADTVITDQVVADDTWDSRFATSGNGIQLQYGAYKGRLVQPSVTRMT
NGRVAAVAMLSDDHGATWYPSVPWGNSMDENKIVELSDGTLMNNSRSSGADTYRKVSYST
DGGVTWTEPTLDTQLPDPRNNASLIRVFPTAPEGSAQAKVLLFSNTATTSGRTNGTVRMS
CDDGQTWPVSKVFEPGAIQYTSMATLPNGDIGMLWENSGSNIDIFYSQFNLSWLEAGCIG
VDADETSVTAGETTTMNVTLTNPFDNAIFDRAVSLELPEGWQAEDVRVSIPSGESVTIPV
QVTAPLVADNGELPVEVSILDGADRYTGRLNLTVQGGQEPAPISVKVSIPNLKDTYVAGE
KISINFAVNNPFDVTVNSVPSLGEGENWMPANLRGFDPEQGTPNCRYKHLGANKSYDCTT
TTYEVSDLDVERGYVDIPTVWTFTNSAGEMVWSKNVDVPRIELNGTQGTVTDAIVTVDPI
NPVHSNGQSQTVEVQANVISEGDLPAGSKVAFYLDSSPIDTAAVDAEGHASISIDVDNIA
SEQTERTFEVRARLVVPEDAPRSIARDALARFTVLPEQVQQNSLVIMNHPDVVSDGQTTT
IVIAAKATAHDGSPVAIGTLITFRVNGIERDVVPTNAQGTAKLQLDLKPVNTEDEEYEVT
VEAELDELTAQTTFKVLAGEEEEPTSTEEQPSETEQPSEPEEEPTGVAGSSNGGSFAALL
ALLAALGGIVGAVLGLLKL
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttccattcaagaaagcaggtcctttgtctcgacgtaaagcagtattctcagcg
cttggtgcagccgcactcatcggcgcagcactacccaccatcccaacggcccaagctcaa
acacccacgggctacggattcgatgcaacagcaagcatcggcgaagaaccagagttttca
acacaacaactcgctgacggcggaactctcggttttgattgctaccgcatcccatcgctt
ggcgtcgcacccaacggcaacgtcctcgcatcgtgggatggtcgcccaaacaactgttca
gatgctccgcaacccaactccatcgtgggcaaggtatcgaccgacaacggagcaacctgg
ggcgaacagcacgacatttccgcaggtatcaccgccgaacccaaaactggctattccgat
cccagcatcgttgtggactgggagaggggcgatgtctttaacttccacgtgaagtcattc
gatgcaggatacttcacctcccaaccaggcacggacccggatgatcgcaacgttgcccat
gttgcctacgccaaatcatcagataacggctcaacctgggttgcagacaccgtcattact
gatcaagtggttgctgatgacacctgggacagccgatttgccacatccggaaacggcatc
caactgcaatacggcgcgtacaaggggcgattggttcagccatcggtaactcgcatgacc
aatggtcgggtcgcagcagttgccatgctgagtgatgatcacggcgcaacgtggtacccc
agtgttccttggggaaactccatggatgaaaacaaaatcgtggaactcagcgatggaacc
ctgatgaacaacagtcgttcatcaggagccgatacttaccgcaaggtgtcttattccacc
gacggcggcgtcacttggaccgagccaactcttgatacccagctgccggatcctcgcaat
aatgcttccctgattcgagtattcccgacagcacctgagggaagtgcgcaggcaaaggtt
ctgctgttctccaacactgccaccacgagtggccgcaccaatggcaccgtccgcatgtcg
tgtgatgatggtcagacttggccggtgtccaaggtgtttgaaccaggagcaatccaatac
acctcgatggcaacgcttcccaacggtgacatcggcatgctgtgggaaaacagtggctca
aatatcgacatcttctactcacagttcaacctgtcgtggctggaggccggctgcattggt
gtcgacgccgatgaaacgtctgtgactgcaggtgaaaccaccactatgaatgtcacgttg
accaatcctttcgacaacgcaatttttgaccgagcagtctcccttgaacttcccgaagga
tggcaagctgaggatgttcgtgtgtcgatcccatctggagaatctgtcacaatcccagtc
caggtcacagcaccgctggtagccgacaacggtgaacttccagtggaggtgtccattctt
gatggagcagaccgctacacgggtcgtctcaatctcactgttcagggtgggcaagaacct
gcaccaatttcagtgaaggtgagcattccaaatctcaaggacacttatgtagcaggggag
aagatcagcattaactttgcggtcaacaacccgtttgacgttacggttaattcggtgcca
agcctgggggaaggcgagaactggatgcctgcaaacctgcgcggatttgatccggagcag
ggtactcccaactgtcgttacaagcatttaggcgcgaataagagctatgactgcaccaca
actacctatgaagtcagcgatttggatgtagaacgcggatacgtggatattccaacggta
tggacgtttactaactccgcaggcgaaatggtatggtccaaaaacgttgatgtgcctcga
attgaactcaatggaacacagggtactgtcactgatgcaatcgtaacggttgatcccatc
aacccagttcattccaacggccagagccaaactgttgaggtccaggctaatgtcatctca
gagggagatctgccagctggatctaaggtggccttttatctagattcatcgcccattgat
accgcagctgttgatgcggaagggcatgccagcatctcgattgatgtggacaacatcgca
agcgagcagactgaacgcacatttgaggttcgcgcccgactcgtcgttccagaagatgca
ccacgatcaatcgcgcgtgatgccttggcacgttttacagtcctgcctgaacaagtgcag
cagaactccttggtgatcatgaatcatccagatgtggtttctgatggacaaacaacgact
attgtcatcgcagcgaaggcgacagcacacgatggatcgccggtggctatcggtactctc
attacatttcgcgtcaacggtattgagcgggacgtggttccaactaacgcgcaagggacc
gcaaagcttcagctagacctcaagccagtaaatactgaagatgaagaatatgaagtaact
gttgaagccgagctggatgaattgactgctcagaccacgttcaaggtacttgctggtgag
gaagaggaacccaccagcaccgaagaacaaccgtcagaaactgagcagccttctgaacct
gaagaggaaccgactggtgttgctggaagctctaacggtggcagttttgctgcgctttta
gcgctgctggcagcgcttggtggcatcgtcggtgcagtcctcggattgcttaagttgtag

DBGET integrated database retrieval system