KEGG   Corynebacterium glutamicum SCgG2: C629_12860Help
Entry
C629_12860        CDS       T02691                                 

Definition
(GenBank) hypothetical protein
Organism
cgg  Corynebacterium glutamicum SCgG2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AGN23162
LinkDB All DBs
Position
complement(2808484..2809575)
Genome map
AA seq 363 aa AA seqDB search
MTVAEFTETTTNAKIITAAVTTSKQTIEFQNLLAPTIVPGSARISMAAVTLCGTDAHIWD
DDYASELPIIQGHEAAGVITEMDPSDEGNGFNIGDRVVICPMFYCGKCYACSVGRVNACK
EMSVYGCYEDGSLVDEQVVPYANLFKIPDSLPLDLAPIVEPISIAMQACKRGRPVSGEKV
IVNGAGPIGVLAVRYLKDQGCEVAVTDMVQSRLDLAKHCGADKTFVVDGGFPNAAQAVEV
DTWTDGNGPSLIIDATGVPAALAAAIDLVATAGRVVCVGISDRDLVFDMRKLVSKEIDLL
GSRNSQNLFPESIALLDKHQDTLRALVTHRFDFDNLDEAFTTLTTPNAGVGKIAIDFPGA
QNV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcgcagaattcaccgaaaccactaccaacgcaaagatcatcacggctgctgtt
actacttcgaagcagaccatcgagtttcagaatcttctagcgccgacgattgtgcctggt
tctgcacgaatctccatggcagcggtcacactgtgtggcactgacgcccatatttgggat
gatgattacgcttcagaactccctattattcaggggcacgaagcagcaggcgttatcact
gagatggatccttctgatgaaggcaacggattcaatatcggcgatcgagttgtaatttgc
cccatgttctactgcggcaagtgctacgcgtgttcggttggtcgtgtgaatgcttgtaag
gaaatgagcgtttacggctgctacgaagatggttctttggttgatgagcaggttgttcct
tacgcgaacctgtttaagattccagattcccttcctcttgatttggcaccgatcgtagag
ccaatctcgattgcgatgcaggcctgcaagcgtggccgtccagtgagtggcgaaaaggtt
atcgtcaacggtgctggcccgattggtgtgctggcggttcgttatctgaaggatcagggc
tgcgaagtcgctgtgaccgatatggtgcagtcccgcttggatctggctaagcactgcggt
gcggacaagactttcgtggttgacggtggtttcccgaacgctgcgcaggcagtggaagtt
gacacctggactgacggaaacggtccatccctgatcattgatgcaactggcgttccagca
gcccttgccgcggcgattgatctggtagcaaccgcaggacgcgtggtgtgcgtgggtatc
tctgaccgcgatctggttttcgatatgcgcaagcttgtatccaaggagattgatctcttg
ggttctcgcaactcccaaaacctgttcccagagagcattgcgctgctggataagcaccag
gacaccctgcgcgcattggttacccaccgttttgattttgacaatctcgatgaggcgttc
actactttgaccacaccaaacgctggtgttggaaagatcgccattgatttcccaggagct
caaaatgtctaa

DBGET integrated database retrieval system