KEGG   Capnocytophaga gingivalis: CGC50_12120Help
Entry
CGC50_12120       CDS       T05260                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cgh  Capnocytophaga gingivalis
Pathway
cgh00061  Fatty acid biosynthesis
cgh00780  Biotin metabolism
cgh01100  Metabolic pathways
cgh01130  Biosynthesis of antibiotics
cgh01212  Fatty acid metabolism
Module
cgh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cgh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CGC50_12120
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CGC50_12120
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CGC50_12120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cgh01004]
    CGC50_12120
Enzymes [BR:cgh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CGC50_12120
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CGC50_12120
Lipid biosynthesis proteins [BR:cgh01004]
 Fatty acid synthase
  Component type
   CGC50_12120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short PG_isomerase_N
Motif
Other DBs
NCBI-ProteinID: ATA87806
UniProt: A0A250FUY6
LinkDB All DBs
Position
complement(2545788..2546597)
Genome map
AA seq 269 aa AA seqDB search
MYNLLKGKKGIIFGALDENSIAWKTAERVHEEGGQFVLTNAPVAMRMGKINDLAEKTGAQ
IIPADATNMEDLQNLVVKAMEILGGKLDFVLHSIGMSVNVRKNIPYTESNYEYYAKGWDV
SALSFHKVCQTLHKNDAMNQWGSIVALTYIAAQRTFPDYNDMADNKAYLESIARSFGYFY
GKDKKVRINTISQSPTATTAGQGVKGFDGFITYANLMSPLGNATAEDCANYTVSLFSDLT
RMVTMQNLYHDGGFSNVGVTPEVIASMNK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtataatttattaaaagggaaaaaaggtatcatctttggtgccttggacgaaaactca
atagcttggaaaacagccgaacgcgtacatgaggagggaggacaatttgtccttaccaat
gctcctgtggctatgcgtatgggaaaaataaacgatttagcagaaaaaacgggtgctcaa
ataatccccgctgatgccaccaatatggaagacctacagaacttagtggtcaaagccatg
gaaatattgggtggaaaattggacttcgtgctacactctataggaatgtctgtgaatgtt
cgtaagaatattccttacactgagtccaactatgagtattatgccaaaggatgggatgta
tctgctctttccttccacaaggtatgccagacccttcacaagaatgacgctatgaatcag
tggggtagtattgtcgctcttacttatattgcagctcagcgtactttccctgactacaat
gacatggccgacaacaaggcttacttggagtccatagctcgtagctttggatatttctac
ggaaaagacaaaaaggttcgtatcaatactatctctcaatctcctaccgccactactgct
ggtcaaggggtgaaaggttttgatggcttcatcacctatgccaatctgatgtctcctctg
ggcaatgccactgccgaggattgtgctaactatacagtaagtctcttcagcgaccttacc
cgcatggttactatgcagaacctataccacgacggaggtttctccaatgtaggagtaact
ccagaggttatcgcttctatgaacaaataa

DBGET integrated database retrieval system