KEGG   Cryptococcus gattii: CGB_A2040CHelp
Entry
CGB_A2040C        CDS       T02232                                 

Definition
(RefSeq) isocitrate dehydrogenase (NADP+)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00020  Citrate cycle (TCA cycle)
cgi00480  Glutathione metabolism
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
cgi01130  Biosynthesis of antibiotics
cgi01200  Carbon metabolism
cgi01210  2-Oxocarboxylic acid metabolism
cgi01230  Biosynthesis of amino acids
cgi04146  Peroxisome
Module
cgi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CGB_A2040C
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CGB_A2040C
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CGB_A2040C
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CGB_A2040C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 10188754
NCBI-ProteinID: XP_003191314
UniProt: E6QZC0
LinkDB All DBs
Position
A:complement(join(406995..407408,407472..407664,407723..408063,408126..408266,408325..408390,408443..408634,408846..408848))
Genome map
AA seq 449 aa AA seqDB search
MLARSTSAFTRSSLLRSTRPLAFAMASRNYASTPAGIERIKVKNPVVEIDGDEMTRIIWK
KIREELILPYVDVDLKYYDLGMESRDATNDQITIDSAEAIKKYSVGVKCATITPDEARVK
EFNLKEMWRSPNGTIRNILGGTVFREPIILDKIPKPVPGWTKPICIGRHAFGDQYRSTDF
LAPGPGKLTLTYTPADGGAPTELNVYDFKGKGVALAMYNTDESIYGFAHASFKMALSKKM
PLFMSTKNTILKKYDGRFKDIFQEVYESTYKTEFEKLGLYYEHRLIDDMVAQAIKSSGGF
VWACKNYDGDVMSDILAQGFGSLGMMTSELITPDGKTMESEAAHGTVTRHYRQYQAGHET
STNPVASIFAWTRGLAFRAKLDETPALEAFAKDLEAACVEVIDKDGIMTKDLALAMKGKD
MTRDDWVTTDVYMKKVNERLVEKLKARSA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctcgaagcacatctgcctttacgcgctcttctcttctccgatcaactagacct
ttagcattcgccatggcttcacgcaactatgcttccacccctgccggtatcgagaggatc
aaggtcaagaaccctgtggttgagattgacggtgatgagatgacaaggatcatttggaaa
aagatcagggaagagctcatcttgccctatgttgacgttgacctcaaatactatgacttg
ggaatggagagccgagacgctaccaacgaccaaatcactatcgactctgccgaggctatc
aagaagtactctgttggtgtcaagtgcgctaccatcacccccgacgaagctcgagtcaag
gaattcaatttgaaggaaatgtggcgaagccctaacggaactatccgaaacatcctcgga
ggaaccgtcttccgagagcccatcattctcgacaagatccccaagcccgtccctggatgg
accaagcccatctgcatcggtcgacacgctttcggtgaccagtaccgatctaccgacttt
ctcgctcccggacccggaaagctcaccctcacttacactcccgctgacggaggtgccccc
accgagctcaacgtctacgacttcaagggcaagggtgtcgctttggccatgtacaacact
gatgagagtatctatggcttcgcccacgcgagcttcaagatggctttgagcaagaaaatg
cccttgttcatgtccactaagaacactatcttgaagaagtacgacggccgattcaaggac
attttccaagaggtctatgaatctacatacaagaccgagtttgagaagctcggtctctac
tatgagcaccgtctcatcgacgacatggtcgctcaggccatcaagtcttctggcggtttc
gtttgggcgtgcaagaactacgacggtgacgttatgagcgacattctcgcccaaggtttc
ggttctctcggtatgatgacctctgagctcatcacccccgacggcaagaccatggaatcc
gaagccgcccatggtaccgtcacccgacactaccgacaataccaagccggccatgaaacc
tctaccaaccctgttgcctccatctttgcctggacccgaggacttgccttccgagccaag
ttggacgagacccccgcgctcgaggcgttcgccaaggacttggaagctgcctgtgttgag
gtcattgacaaggacggtatcatgaccaaggacttggctttggcgatgaagggcaaggac
atgaccagggatgactgggtcaccactgacgtatacatgaagaaggtcaacgagaggttg
gtcgagaagctcaaggcgaggagcgcgtaa

DBGET integrated database retrieval system