KEGG   Cryptococcus gattii: CGB_A3140WHelp
Entry
CGB_A3140W        CDS       T02232                                 

Definition
(RefSeq) alpha-1,2-mannosyltransferase
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CGB_A3140W
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cgi01003]
    CGB_A3140W
Enzymes [BR:cgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     CGB_A3140W
Glycosyltransferases [BR:cgi01003]
 Glycan extension
  Yeast mannan chain
   CGB_A3140W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 10188828
NCBI-ProteinID: XP_003191322
UniProt: E6QZK6
LinkDB All DBs
Position
A:join(636367..636414,636471..636672,636738..636838,636894..636991,637050..637155,637206..637287,637343..637450,637501..637593,637650..637855,637911..637984,638049..638085)
Genome map
AA seq 384 aa AA seqDB search
MMIPRWKYIGIVGGMVLLLHILLSIHPTYRDKTSPFNLLPQQDGWREGQAPPESAIPPVV
GDLAENEAALEGRRKANAVFVVLARNSDLWPFLDSMRQMEDRFNHWAKYDYVFLNEEDFS
DEFKRYTQSMTKAKCHYGKIDPEHWYQPEWIDEEKATKAREEMIRKKVIYGHSVPYRNMC
RFNSGFFFRHPLLANYDYYWRIEPSVKFFCDLAYDPFLVMQDQNKVYGFTISLFEYIETI
PTLWDAVKEYIGEHPEYLPEGNAMQFLSDDGGETYNKCHFWSNFEIGDLNFWRSQPYMEF
FDFLDKKGGFYYERWGDAPVHSIGAALFSKKEQIHFFDDIGYRHEPFQHCPQGDAHTRGN
CWCDQANNFDWEWYSCTKKYTEMF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatgattccccgttggaaatatatcggcatcgtgggaggaatggtcctcctcctccat
atcctcctatccattcaccctacttatcgagacaaaacctcaccttttaaccttttgcct
caacaagacggatggcgtgaaggccaagcacctcccgaatctgccatccctccagttgtt
ggcgatcttgcggaaaatgaggccgctttagaggggagaagaaaagctaatgcagtcttt
gtcgttttggcccgaaactcggacttgtggccattcctcgactctatgcgacagatggag
gatcgattcaatcattgggctaaatatgattatgtctttttgaacgaagaggacttctct
gacgaattcaaaaggtacactcaatcaatgaccaaagccaaatgtcactatgggaagatt
gatcccgaacattggtaccagcctgaatggattgatgaagaaaaggctaccaaggctcga
gaagaaatgatcaggaaaaaggtcatttatggtcactccgtcccttatcgaaacatgtgc
aggtttaactcaggtttcttcttccgacatcccctcctcgccaattatgattactactgg
cgaattgagccgtctgtcaagttcttttgtgacctcgcctatgatcccttccttgttatg
caggatcaaaacaaggtgtacggctttaccatttccctgtttgagtacattgagaccatc
cccactctttgggatgctgtcaaagaatacatcggggagcatcccgagtatcttcctgaa
ggcaatgcgatgcaattccttagcgatgacgggggtgaaacctataacaagtgccacttc
tggtccaactttgagattggagaccttaacttttggcgatctcagccttatatggagttc
tttgatttcctcgacaagaaaggtggattctactatgagcgatggggagatgcgcccgtg
cactcgatcggtgccgcgctcttctccaaaaaggagcagatccacttctttgatgacatt
ggctacagacacgaaccgttccagcattgccctcagggtgatgctcatactagaggtaac
tgttggtgtgaccaagcgaataacttcgattgggagtggtactcttgcaccaagaaatat
acagaaatgttctaa

DBGET integrated database retrieval system