KEGG   Cryptococcus gattii: CGB_A6120CHelp
Entry
CGB_A6120C        CDS       T02232                                 

Definition
(RefSeq) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cgi  Cryptococcus gattii
Pathway
cgi03030  DNA replication
cgi03410  Base excision repair
cgi03420  Nucleotide excision repair
cgi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CGB_A6120C
   03410 Base excision repair
    CGB_A6120C
   03420 Nucleotide excision repair
    CGB_A6120C
   03430 Mismatch repair
    CGB_A6120C
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cgi03032]
    CGB_A6120C
   03400 DNA repair and recombination proteins [BR:cgi03400]
    CGB_A6120C
Enzymes [BR:cgi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CGB_A6120C
    6.5.1.6  DNA ligase (ATP or NAD+)
     CGB_A6120C
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CGB_A6120C
DNA replication proteins [BR:cgi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CGB_A6120C
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CGB_A6120C
DNA repair and recombination proteins [BR:cgi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CGB_A6120C
   NER (nucleotide excision repair)
    Other NER factors
     CGB_A6120C
   MMR (mismatch exicision repair)
    Other MMR factors
     CGB_A6120C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_N DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 10188854
NCBI-ProteinID: XP_003191605
UniProt: E6QY39
LinkDB All DBs
Position
A:complement(join(1219851..1220040,1220091..1220253,1220314..1220466,1220525..1220915,1220973..1221291,1221356..1221864,1221916..1221933,1221994..1222405,1222477..1223159))
Genome map
AA seq 945 aa AA seqDB search
MPVDTSVKKRTKLKAASITPPSKKFKQAAVIQQRPISSFFHSPAKSSVKAKEVIVIEDSD
SDDYPQSSTQAATAHGGNGNLESSRNCDLQPPEEGQMSSLGYVKEKNGHDLASTSGIFHE
RLKATPNGTAISSLTEGQGSNDRVHYFSRNPKRITGDELAITSNIITSASKDSAEKIDFD
HDPFTFDPSQIAATSWPKGRLPYSILVGVYGQVSSTKSRLAIIRILTNFLHLLMHTSPPD
LTPCLYLLSNHLTPSYIHCDLGIGSSILSKSIQEVSGLQARDLKHLWQKYGDPGDVAFEA
RSKLRTLVQPAPLLAGEVYDKLLEISRVKGNNSGKIKNELVRKLLIRAKGEEVRFLVRSI
IGNLRIGAVRLTLLTALARATTIIRLPADLKQSIIPLLRATVNADGNDKRSVITKARPDV
ARDTAETLCLDAIRIVRKVYVRHPNYGDLVAGLKEGVESLEDKVPVSVGIPLSPMLGSIT
RSMNEVFTRLGHLSFTAETKLDGQRGQLHVRLDGPEGKDDGGGRWVNADNGTKLWVRLFS
RHLEDMTDKYPDICHLALELLSRPLPTERPPFPALSSQPSSRVLDLLNISNVTSVVMDTE
IVALDKDNGNFRTFQELSNRGKKDVKMEDIKVVVGVFAFDLMVINDVSLLDLPFSHRRHL
LHTLLPSFTPKSNQVGHPVARFTHVEYIDSANLTDPAAELQTFFERVVEKKCEGLMVKLL
ENGEGLAGEDATEDDLDRERGQEIKSEQKNGGRNKRQPLPATYEPDQRSQGWLKVKKDYL
EGLGDSLDLVPIGAWWGQGRKAGWWSPILLACHNPDSGALEAVCKCMSGFSDAFYKDLSK
RYPAEGMPGKCSKIAPLGFVNTNGLIPDVWFEPSEVWEIKGADITLSPVYPAASSHLGSE
RGLSVRFPRFIRMRDDKKWEDAMTSDQLADMYRRQMKESETTTKD
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttgataccagcgtcaaaaagcggacgaaactcaaggcagcatccatcacaccg
cccagtaagaagttcaagcaagcggccgtcatccagcaacgtccaatatcgtctttcttt
cattcacctgctaaaagcagtgtcaaggccaaagaggtcattgtcatagaggattcagat
tccgatgattatccccagtcctcgacgcaggcggcgacagcacatggcgggaatggtaat
ttggaatcctccagaaactgcgatctccaaccacctgaagaaggtcagatgagctcccta
ggatatgtgaaggagaaaaatggacatgatctggccagtacttcaggaatttttcatgaa
agactaaaggcaacgcctaatggaacggctatctcatcactaacggaaggacaaggatca
aatgatcgagtacactacttctcccgaaaccccaagagaataacgggcgacgaacttgct
attacctccaatatcattacatctgcttcaaaggactcggctgaaaagatagattttgat
cacgatccattcaccttcgatccgtcccaaattgcagcaacttcttggcctaagggtcgt
ctaccatacagtattctcgtcggtgtgtatggacaggtttccagtacaaaatcacgacta
gctatcatacgaatcttgacgaatttccttcatttgctcatgcatacttcaccaccagat
ttaacaccttgcctttatctcctttccaatcaccttaccccttcctatattcattgcgat
cttggcattggatcttctatactgtcaaaaagtatacaagaagtctcgggtcttcaggct
cgagatctcaaacacctatggcaaaaatatggcgatcctggtgatgtcgctttcgaagcg
agaagtaaactacgaacattagtgcagccagccccacttctggcgggggaagtgtacgat
aagttgttggaaatttcgagagtgaaggggaataatagcggaaaaattaaaaatgagcta
gtcaggaagttgttgatccgggccaaaggagaagaagttagatttcttgtccgaagcata
ataggcaacttgaggataggtgccgttagacttactcttttgaccgccttggcacgcgcc
acgaccataatacggcttccagctgaccttaaacagtctataatacccctcttaagggcc
acagtcaacgctgacggaaatgataaacgctcagtcattacaaaggcccgaccagacgtc
gctcgcgacaccgctgagactctctgtctggatgccatacgcatagtgcggaaagtgtat
gtgcgacatccaaattacggagaccttgtcgctggcctcaaggaaggagttgaaagtttg
gaggataaagtgcctgtgagcgttgggatcccactgtctcccatgctagggtccatcaca
agatcaatgaatgaagtgttcacgagattagggcatctttcgtttacagcagagactaaa
ctagatggtcagagaggacagcttcatgtcagactggatggtcctgaaggaaaagatgat
ggcgggggtagatgggttaatgcggataacgggaccaaactttgggttagactattcagc
aggcatttggaagatatgaccgacaagtaccccgatatctgtcacctagctcttgaactt
ctctcgcgacctcttccgacagaacggccgccattcccggcgctttccagtcaaccttcg
tcaagagtcctcgacttgctgaacataagtaatgtcacatcagtggtcatggataccgaa
attgtagctttggataaagataacggtaacttccgaaccttccaggagctatccaacaga
gggaaaaaagacgtgaaaatggaggacatcaaagttgtagttggggtttttgcctttgac
ttgatggtcatcaatgacgtgtcattactggacctccctttttcacatcgaaggcatctc
cttcacactctgctcccctctttcactcccaaatcaaatcaagttggacaccctgtggca
cgctttacacacgtcgaatacattgactctgccaatctcaccgatcctgctgcggagttg
caaacattcttcgaaagggttgtagaaaaaaaatgcgaaggcttgatggtcaaattatta
gaaaatggtgaaggcttggcaggggaagatgcaacagaagatgatttagatcgtgaaagg
ggccaggaaattaagtcggagcagaaaaacgggggtaggaacaagcgtcaacctcttccc
gccacctatgagccagatcagcgcagtcaaggttggctcaaggtaaagaaagattatctt
gaagggttaggggattctctcgatctcgtacccattggcgcatggtggggtcaaggccgt
aaagcgggttggtggagtcctatcctcttagcctgccacaaccctgacagtggcgccctg
gaagcagtctgcaaatgcatgtctggtttttcagatgcattttacaaagatcttagcaag
cgttatcccgctgaaggaatgcccggcaaatgcagcaagatagcacctcttggattcgta
aatacaaatggtttgataccagacgtgtggtttgagcctagcgaagtatgggagattaaa
ggcgccgatatcaccctctctcccgtctatccggcggcttcgtcgcatcttggatctgaa
agggggttgagtgtccgatttcctcgtttcatacgcatgcgagatgacaagaaatgggag
gacgctatgacgagtgatcaacttgccgacatgtacaggcgccagatgaaggaaagcgag
acgacaaccaaagactag

DBGET integrated database retrieval system