KEGG   Cryptococcus gattii: CGB_A7180CHelp
Entry
CGB_A7180C        CDS       T02232                                 

Definition
(RefSeq) histone deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cgi  Cryptococcus gattii
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cgi03036]
    CGB_A7180C
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CGB_A7180C
Chromosome and associated proteins [BR:cgi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CGB_A7180C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 10187814
NCBI-ProteinID: XP_003191667
UniProt: E6QYB2
LinkDB All DBs
Position
A:complement(join(1436868..1437716,1437769..1437966,1438032..1438239,1438316..1438377,1438498..1438703,1438756..1438796,1438853..1439031,1439106..1439642))
Genome map
AA seq 759 aa AA seqDB search
MAASECPLGLYVQPACLQHRYIRHTNASHIFERPERLRAVLLGVAAAVARLEQRNTADDL
ASLLSSLSLVSPAQPTAHLHLVPAPPLPPTPGNILLHHPAVQLAHSPVPDAPFPYIGPPS
TGPSGASFPSSSYLRDLVKWSNGAVDRIKQTGCEIPEGLGLNPGDLYLGPGSIIAIEGAI
QTVCQAVDHVVRKPKPVSIKEEEPSTPPVEGPADGPLFTKAFCAIRPPGHHCGEDAPSGF
CYVNNVVIGALHGYLQHDIDRAIIIDFDLHHGNGTQALVMPLNAASYADDIQVKAGKPPI
IGQGGRRRRGWKGFYGSVHDIDGDLDLIRDASISLAAHGQYIENIHLKPYTSEADFYERI
YPLYLALLDKAKVFMEETEANPERTIVFISAGFDACEWEHQGMQRHDRRVPVSFYSRYTR
DIAAFADKYTEGKVVSVLEGGYSDRALTSAAMGHIVGMRGSLPEGCDEWWTERELINLEK
ATKKKRGGKLAPLPAEFATQPHLSRTHSLLAHFEGVTSTESVASTATNTPMGTRMTLRDR
RRADEAGRASVESTPGSGGAKRGKGRAVAAVVGTPATSKLKTSSHPIPTDTSSVEPETNT
VAPSHNYTPLTDKTLETTQSSLEKSVRREKEMGDWIEEAVKDITKMSLEEHASTPVPEHE
FKSQSSPPLSQTPTTTTTTTALLPKIILRIPARPTIDNTAEQPHPIPPPSSQSDQQPPLD
TEQPPLDIETQARTPSSEAVTYNSTATAAELLNHIAGGH
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggccgccagcgagtgccctcttgggctgtacgtgcagccggcgtgtctccagcacaga
tacatccgccatacaaacgcatcccacatattcgagcgtccagagcgactccgcgcagtg
ctcctcggcgtcgctgctgcagtcgccaggctcgagcagcgcaacactgcagacgatctc
gccagcctcctctcctccctgtccctcgtatcccctgcccagcccacagcccacctccac
ctcgtgcccgccccgcccctcccgcccacgcccggcaacatcctcctgcaccatcccgca
gtccagctcgcccactccccagtccccgacgccccttttccatacatcggcccaccgtcc
acaggcccttctggcgcaagtttcccgtcgtccagctatctcagggatctggtcaagtgg
tccaacggggcggtggacaggatcaagcaaacgggatgcgagataccagagggactggga
ctgaaccctggagatctttatctcggccctggaagtatcattgccatcgagggcgctatt
caaacagtttgtcaagcggtagatcatgtagtgcggaaaccaaaaccggtatccatcaaa
gaagaggagccgtctacaccccctgtggaaggtcctgcagatgggccattgttcacgaaa
gcgttttgtgcgataagaccaccaggtcatcactgtggtgaagatgcaccctctgggttt
tgctatgtcaacaacgtggtcattggcgccctgcatggctacctccaacacgacattgat
cgcgcaatcatcattgatttcgatctgcaccacggtaacggcacgcaagcgctcgttatg
cctctcaacgcggcttcctatgcggatgatatccaggtcaaggcgggaaagccaccgatc
attggacaaggagggagaagaagaagaggttggaaggggttctatggatcagtgcatgat
attgatggcgatcttgatctcattcgagacgcctccatctctctcgctgctcatggacaa
tacatcgaaaatatccatcttaaaccatacacctctgaagccgatttctacgaacgaatc
tatcctctctatcttgcgctcttggacaaggccaaggtatttatggaagagactgaagcg
aacccagagagaacgattgttttcataagtgcaggattcgatgcttgtgaatgggaacat
caaggaatgcagcggcatgatcgacgagtacccgtttcgttctattcaaggtatacgcgt
gatattgcagcttttgcggacaagtacaccgagggcaaggttgtctccgttttagaaggc
ggttacagcgatcgcgctttgacaagtgcggccatgggtcatattgtgggaatgagaggg
tcgttgcctgaaggatgtgatgagtggtggacagaaagagagctgattaatttggaaaag
gcaacgaaaaagaagagaggaggtaaacttgcccctcttccagcagagtttgccacacaa
ccccatctctctcgaacacactctctccttgcccattttgaaggggtgacttcaacagag
tcagtcgcaagtacagctacaaatacgcccatggggacaagaatgaccttgcgcgataga
agaagggcggatgaggctggtagagcgagtgtagagagtacacctggttccggtggggcg
aaaaggggcaagggaagggcggtagcggcggtggtggggacaccggcaacatccaagctc
aagacatcctcgcaccccattcccacagatacatcctctgtggagccagaaactaacaca
gtagctccttcgcacaactatacaccattaacggataaaacgctcgaaacaacacaatct
tcgttggaaaagagtgtaaggagagaaaaagaaatgggagactggattgaagaagctgtc
aaagacattacaaaaatgtctctggaagagcatgcatccacaccggtaccggaacacgaa
ttcaagtcccagtcgtccccgcctttatcacaaactccaacgaccacgaccacgacgacg
gctttactacccaaaattatcctccgtattcccgcacgcccaactatcgataatactgcc
gagcaacctcaccccatcccaccaccctcatcacagtcggaccaacaaccccctctcgat
accgaacaaccccctcttgatatcgaaacacaagctcgaaccccatcttccgaggctgtt
acatacaactctacagcgaccgccgccgagcttttaaatcacattgccggcggtcactag

DBGET integrated database retrieval system