KEGG   Cryptococcus gattii: CGB_B5780WHelp
Entry
CGB_B5780W        CDS       T02232                                 

Definition
(RefSeq) oxoglutarate dehydrogenase (succinyl-transferring)
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00020  Citrate cycle (TCA cycle)
cgi00310  Lysine degradation
cgi00380  Tryptophan metabolism
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
cgi01130  Biosynthesis of antibiotics
cgi01200  Carbon metabolism
Module
cgi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CGB_B5780W
  Amino acid metabolism
   00310 Lysine degradation
    CGB_B5780W
   00380 Tryptophan metabolism
    CGB_B5780W
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CGB_B5780W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 10187645
NCBI-ProteinID: XP_003192274
UniProt: E6R126
LinkDB All DBs
Position
B:join(1298393..1298593,1298641..1298893,1298941..1300546,1300602..1300899,1300956..1301273,1301342..1301542)
Genome map
AA seq 958 aa AA seqDB search
MYRLWKQDPKSVHVSWQTYFSGLDKGLPSSEAFNPAPGFVSGVVPTPAGGSPKLSVKGSG
DVTDYLKVQLLIRAYQVRGHHIANLDPLHISGADLDGRVPPELTLDYYGWTEADLKKEFS
LGDGILPRFKGQVKDDTMTLGQIIDELKQMYCTHIGCQYVHIPDRGQCDWIRERVEIPTQ
WNYSVEEKRMILDRLMWSELFEKFIASKYPNEKRFGLEGCESLIPGMKALIDRSVDAGVK
SIVLGMPHRGRLNVLGNVIRKPIEAILNEFKGNEDAGDTGGGDVKYHLGANYIRPTPSGK
KVSLSLVANPSHLEAEDPVVLGKTRAIQHFEGDEGDGSSAMGVLLHGDAAFAGQGVVYET
MGMQNLPNYGTGGTIHLIVNNQIGFTTDPRFARSTPYPSDIAKSIDAPIFHVNSDDVEAV
NYVCTLAADWRATFKKDVVIDIVCYRRYGHNETDQPSFTQPKMYKAIQKQPTVLSIYTDK
LIKEGTFSEKEIDEHRQWVWGMLEKAYDGSKDYKPSPREWLSSSWEGFPSPKELAEEVLP
QLHTGASEDTLKQVGQVISSFPDGFHPHKNLARIIGNRGKTVSEGKNIDWSTAEALAFGT
LCLEGTHVRISGQDVERGTFSQRHAVVHDQETEQTHVALKHLSADQGSFTVTNSHLSEFG
TLGFELGYSLVSPNSLTIWEAQFGDFANNAQCIIDQFIAAGERKWLQRTGLVLSLPHGYD
GQGPEHSSGRIERFLQLCDDEPRVYPSPEKLERQHQDCNMQIVYPTTPANYFHVLRRQNK
RDFRKPLIVFFSKSLLRHPLARSTLEEMSGDSKFQRYLPEPHPESLIEPEKIRRHILCTG
QVYFQLLKEREERGINDVAISRIEQLSPLPYDLLTPHLDKYPNADVVWAQEEPLNNGGWT
YVQPRLITALKETEHHKSKVPIYAGRKPSSSVATGFKYAHKKEIEMINDMAFGPAEGQ
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcctctggaaacaagatcccaagtctgtccacgtatcctggcaaacttacttc
tctggtctcgacaagggtcttccctcttctgaggccttcaaccccgcccccgggtttgtc
tctggtgtcgttcccacccccgcaggtggaagtcccaaactttctgttaagggcagtggt
gatgtcaccgattaccttaaagttcaacttttgatccgtgcctaccaagttcgaggtcat
cacattgccaacctcgatcctctccacatctctggtgccgatctcgacggtcgtgtccct
cccgagcttacactcgactactacggttggactgaagccgacctgaagaaggaattcagt
cttggcgacggtattctcccccgattcaagggtcaggtcaaggacgacactatgactttg
ggccagatcattgatgagctcaagcagatgtactgtacccacattggttgccagtacgtt
cacatccccgaccggggacaatgcgactggatccgggagcgcgtcgaaattcctacccag
tggaactattccgttgaggaaaagaggatgatccttgatcgactgatgtggtctgagctt
tttgagaagttcattgcctccaaataccccaacgagaagcgtttcggtcttgagggttgc
gagtctttgatccctggtatgaaggcgctcattgatcgttccgtcgatgctggcgtcaaa
tctatagttcttggtatgccccaccgtggtcgtcttaacgttcttggtaatgtcatccga
aagcctattgaggccattttaaacgagttcaagggtaacgaggatgccggcgatactggt
ggtggtgatgtcaagtaccaccttggtgccaactacatccgtcctactcctagcggcaag
aaggtttccttgtctcttgttgccaacccttcgcatttggaggccgaagaccccgtcgtc
ctcggtaagaccagggctattcagcactttgaaggtgacgagggagacggatcctctgcc
atgggtgtcttgctccacggtgacgccgccttcgctggtcaaggtgttgtctacgaaacc
atgggtatgcagaacctccccaactacggcactggtggtaccatccacttgattgtcaac
aaccaaattggtttcaccaccgacccccgatttgctcgttctaccccttacccgtctgat
attgccaagtctatcgatgcccccatcttccacgttaacagtgacgacgtcgaggcggtc
aactatgtctgtactctcgctgctgactggcgagctaccttcaagaaggatgtggttatt
gacattgtctgttaccgacgatatgggcacaacgagactgaccaacccagcttcactcag
ccgaaaatgtacaaggctattcagaagcaacctaccgtcttgtctatctacaccgacaag
ttgattaaagagggtactttcagtgagaaggagattgacgagcacagacaatgggtctgg
ggcatgcttgagaaggcttacgacgggtccaaggactacaagccttctccccgagagtgg
ctttcctcctcttgggaaggtttcccttcccccaaggagctcgccgaggaggttctccct
cagctccataccggtgccagcgaggacaccctcaagcaggttggtcaggtcatttctagt
ttccccgacggcttccatccccacaagaatcttgcccgaattattggtaaccgaggcaag
actgtatctgaaggcaagaatattgactggtccactgccgaagctcttgctttcggtact
ttgtgccttgagggtacacacgttcgaatttccggtcaggatgttgagcgtggtactttc
tctcagcgacacgctgtggtccacgaccaagagaccgaacagacccacgttgctctcaag
catctcagcgccgaccagggttctttcactgttaccaactctcatttgtctgagtttggt
accctcggtttcgagctcggttactctcttgtctctcccaacagtttgacgatttgggag
gctcagtttggtgactttgccaacaatgcccaatgtatcattgatcaattcatcgctgcc
ggtgagcgaaagtggctccagcgaactggtctggttctctccttgcctcatggttacgat
ggtcaaggtcccgagcactcttctggtcgtatcgagcgattcctccagctttgtgatgat
gagccccgagtgtatccttcacctgaaaagttggagaggcagcaccaggactgcaatatg
cagatcgtctaccccactacccctgccaactatttccacgttctcaggcgacaaaataag
cgagacttccgaaagcccttgattgtcttcttctccaaatcccttctccgacatcctctt
gcccgatctactcttgaggagatgtctggtgactccaagttccagcgatatctccccgaa
cctcatcccgaatcgcttatcgagcccgagaagatccgacgacacattttatgtactggt
caggtctacttccagctcctgaaggagcgagaagagcgaggtatcaacgatgttgccatt
tcaaggattgagcaattgtctcccttgccatatgaccttttgactcctcatcttgacaag
taccccaatgcggacgttgtctgggcccaggaggagcctcttaacaacggtggatggacc
tatgttcagcctcgactcatcaccgccctcaaggagactgaacatcacaagtccaaggtg
cccatctatgctggtaggaagcctagcagttctgttgccaccggtttcaagtatgcccac
aagaaggagattgagatgatcaacgatatggcatttggtcccgccgaaggacagtga

DBGET integrated database retrieval system