KEGG   Cryptococcus gattii: CGB_E3410WHelp
Entry
CGB_E3410W        CDS       T02232                                 

Definition
(RefSeq) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00500  Starch and sucrose metabolism
cgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CGB_E3410W
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CGB_E3410W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 10190437
NCBI-ProteinID: XP_003194280
UniProt: E6R718
LinkDB All DBs
Position
E:join(665462..665827,665890..666167,666239..666442,666497..667285,667343..667433)
Genome map
AA seq 575 aa AA seqDB search
MASRTDMESDLLSCEKGLLPRSVTLRPPGSIIEHNHHRYRSVVTKGLFLCLLILSAIVTK
ASLGLWSHCLNSQSIHFDHQSNHQSLLLESRILANIGPGIGAKEGLVVASPSRGHGKEPD
YYYTWTRDSALTISTLISHLRSDLADIDNATESWEMYSALSDTLKEYLFRDYIESQAEIQ
IGKNPSGDLKSGGLNEPKFHVNGTPFIGNWGRPQRDGPALRAITIMIYANFLLDRGFPSD
VSYVKQWIYDPRQLKAPGKVLKNDLEEVAHGWSKGGFDLWEEVNGHHLFTLLVSRKALYH
GSIFARRLKDVGAADHYLAQAHSITQKIPLFWDSKRGYWLSSLRSRGLELVQIKSEFDPT
NTYPRREWLDCALPLSIIHAGSHTLQPSHNFSFPFSAIDPNVLSTMHLYIKSFDGLYGIN
DGKSWLDGWALGRYKEDVYDGKGHSQGNPWFICTFSLAHSLYLAYKEFREVGAIVVANQT
LSFWEGVVSISSTPPKVVAGDVWIEGRDRRFTEGMKCLKEVAGRFMEVGLKVAKENGGRM
SEQIGRDDGQFKGARDLTWSYASLLDLIRVRSDLD
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagaacagatatggaatccgatcttctctcgtgcgaaaagggtctactaccc
agaagtgtgactttgcgaccacctggctctataattgaacacaaccatcacaggtatagg
agtgtggtcaccaaggggctgtttctctgccttctcatattatctgcgatagtaaccaaa
gcctctctaggactttggtcccattgcttaaattcgcagtcgatacattttgatcaccag
agtaatcaccaaagtcttcttttggaatctagaattttggcgaacataggacctggtata
ggtgcaaaggaagggcttgtggtggccagtcctagtagggggcatgggaaagagcccgac
tactactatacctggactcgtgattctgctctaaccatttccacattgatatctcatttg
agatctgatttagccgatatcgacaatgccaccgagtcctgggagatgtacagcgcgctg
tctgacacactgaaggaatatctctttcgggattatatcgaaagtcaagcagaaatacaa
ataggcaaaaacccctcgggtgacttaaaatcaggcggccttaatgaaccaaagttccat
gtcaacggtacccctttcataggaaattggggaaggcctcagagagacggtccggcgctc
cgggccattactataatgatctatgccaattttcttcttgatcgtggatttccttcagac
gtcagttacgtaaagcaatggatctatgaccccaggcagctcaaagcaccaggaaaggtt
cttaagaatgatttggaagaagttgctcatgggtggtcaaaaggcggctttgatttatgg
gaagaggttaatgggcatcacctattcactcttcttgtatcccgtaaagccttgtaccat
gggtcgatatttgcgagacgtctcaaagacgttggcgcagcggatcattacctcgcccaa
gcgcactctattacgcagaaaattccacttttttgggactccaaaagaggctattggctc
tcaagtttgagaagtcgcggtcttgagcttgtacagatcaaatctgaatttgacccgacc
aacacatacccaagacgagaatggctcgattgtgcgctacctctgtctatcatccatgca
ggttcccacaccctccaacccagtcacaatttctcttttccgttctctgcaatcgatccc
aatgtcctttcgacaatgcatctttatatcaagtcttttgatggactttacggtatcaat
gatgggaaatcttggttagatggatgggcattggggcgctataaggaagatgtatatgat
ggtaagggccatagtcaagggaacccctggttcatttgcacgttttctcttgcccatagc
ctgtacctcgcctacaaggagtttcgagaggtaggtgccattgtagttgccaaccaaacc
ctttcgttctgggagggtgtcgtttcgatctcatctacacctccaaaagttgtggctgga
gatgtgtggattgaaggaagagatcggcggttcacggaggggatgaaatgtttgaaagag
gttgcaggcagattcatggaagtcggcctgaaagtggcaaaggaaaacgggggaaggatg
agcgagcaaatcggcagagatgatgggcaattcaaaggtgcaagggatctgacgtggtca
tatgctagcttattggatctgatcagggtcaggtcagatttggattga

DBGET integrated database retrieval system