KEGG   Cryptococcus gattii: CGB_E5300CHelp
Entry
CGB_E5300C        CDS       T02232                                 

Definition
(RefSeq) chromatin remodeling-related protein
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
cgi  Cryptococcus gattii
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cgi03021]
    CGB_E5300C
   03036 Chromosome and associated proteins [BR:cgi03036]
    CGB_E5300C
Transcription machinery [BR:cgi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     CGB_E5300C
Chromosome and associated proteins [BR:cgi03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    CGB_E5300C
   PBAF complex
    CGB_E5300C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SWIRM SWIRM-assoc_1 Myb_DNA-binding Myb_DNA-bind_6 ZZ Trypan_PARP SANT_DAMP1_like NYAP_C
Motif
Other DBs
NCBI-GeneID: 10190726
NCBI-ProteinID: XP_003194448
UniProt: E6R7E7
LinkDB All DBs
Position
E:complement(join(1034456..1035892,1035941..1036347,1036412..1036607))
Genome map
AA seq 679 aa AA seqDB search
MSTPKISLRISTPADADSQQQEQQVEATGQGVQTHDVASAPGKEKEREPHYGGEIANISV
PVDSGEPSATPRDAAATETPAEETPAPEPERPTPAQLHDLATTYLAAQTHPLIIPSYSSW
FSLTTIHPIERRSLPEFFSSRNRSKTPSVYKDYRDFMVNTYRLNPGEYLTVTACRRNLAG
DVGAIMRVHAFLEQWGLINYQVDPDTRPAALGPPFTGHFRVTLDTPRGLSNLLHPGVRPG
ACALSQTNGVTPHPSNLDLRKTIYHSTSRTTKPVSAEDATKLASANGDVPKSKTYVCETC
GTDCTTTRYHSLKDGEYTICPSCFVSGRFPSTMYSGDFVRLDEEAFKHASASVGADWSDQ
ETLLLLEGVEMFDDDWQAVADHVGSRSKESCISKFLQLPIEDPYLTQEPAADLGPLRYQA
GMNGLPFEGGENPVMSVVAFLASQVGPAVAAAAAQSALGELAKGLKRKRNDGEKEGEKEG
KVAKSDVEKKESDEEEEKEKEGEAEPMAVDDATEQPAEPSTAPVENTETEANLSIPSASD
LSRAATLALSSAAAKASALASHEDHRISQLVSRLVTVQTRKVELKLSMFERLEELLENEK
RSIELARQNLFRDKQTVKKQLAQVEELLKKAKEGDKGVEGEVAGLKKDIETGSTAEAVKE
VQGAANEPAVEGDTTLGKL
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacccccaagatatccctccgcatatccacaccagcagacgcagacagccagcag
caggagcagcaagtggaggctacaggccagggcgtgcagactcacgacgttgccagtgcg
ccggggaaggaaaaggagcgagaaccgcattacggcggagagattgccaacatcagtgtg
ccggttgatagtggggaaccgtcggccactcctcgcgacgccgccgcgacagagacgcct
gcagaagagacaccagcaccggaacccgaacggccaacgcctgcccagctacacgatctc
gcaaccacctatctcgctgcccagacccaccctctcatcatcccttcgtattcatcatgg
ttctctctcaccactatccacccgatcgagcgtcgctccttgcccgagttcttctcgtca
agaaacaggagcaagaccccgagcgtgtacaaggactatagagattttatggtcaacaca
tacaggctaaaccctggagaatacttgacggtgacggcgtgcaggaggaacctggccggt
gatgttggcgccatcatgagggtgcatgcctttttggaacagtggggattgattaattac
caggtcgaccccgatactcggccagcggcacttggtccgccttttacaggtcacttccgg
gtcaccctcgacactcctcgtggcttgtccaacctcttgcatcctggtgtcaggcccggt
gcctgcgccttatcccaaaccaatggtgttactcctcacccttccaacctcgacctccgc
aaaaccatctatcactccacttctcgcactaccaagcccgtttctgccgaagatgcgaca
aaactcgccagcgccaatggcgacgtacccaaatccaagacttatgtgtgtgagacttgc
ggtaccgattgcacaacgacaagatatcactccctgaaggatggcgagtacaccatttgt
ccgtcatgttttgttagtgggcggttcccctccaccatgtactctggcgactttgtccgt
ctcgacgaagaagccttcaagcacgcttcagcttctgtcggcgccgactggtcagatcaa
gaaacattgttgcttcttgaaggtgtcgagatgtttgatgacgactggcaggcagttgcc
gaccacgtcggaagtcgttccaaagaatcttgcatttctaaattccttcagttaccgatc
gaagacccgtatctcacccaggaaccggctgccgatcttggaccgttgagatatcaagcc
ggtatgaatggattgccgttcgaagggggagagaacccagtgatgagcgtagtggccttc
ttggctagccaagttgggccagctgtagcagcggcggccgcacagagtgctttgggagaa
ttggctaaggggttgaagaggaagaggaatgatggagaaaaggaaggagagaaagagggc
aaggttgcaaagagtgatgtggagaagaaggaaagcgatgaggaagaagaaaaggaaaaa
gaaggcgaggctgaacctatggctgttgacgacgccacagaacaaccagcagagccctca
acggctccagttgaaaacacagagacagaagccaacctctccattccttctgcatccgat
ctttctcgcgccgccactcttgccctttcttctgctgctgcaaaagcatccgctcttgct
tctcacgaggatcatcgtatctcccaacttgtctcccgtctcgtcactgtccaaactcgt
aaagtcgagctcaaactatccatgtttgaacgtcttgaagaattgcttgaaaacgaaaag
agatcgatcgagttggcgaggcaaaatttgttcagggataagcaaacggtcaagaaacag
ttagcgcaggtggaagaattgttgaaaaaggcaaaggagggagataagggggtcgaaggg
gaagtcgcaggtttgaagaaggacattgagactggaagcacagccgaagctgttaaagaa
gtgcagggggcggccaatgaaccggcagtagaaggtgatacaacattgggaaagctttag

DBGET integrated database retrieval system