KEGG   Cryptococcus gattii: CGB_F5660CHelp
Entry
CGB_F5660C        CDS       T02232                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00052  Galactose metabolism
cgi00500  Starch and sucrose metabolism
cgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CGB_F5660C
   00500 Starch and sucrose metabolism
    CGB_F5660C
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CGB_F5660C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459
Motif
Other DBs
NCBI-GeneID: 10190495
NCBI-ProteinID: XP_003194901
UniProt: E6R8N1
LinkDB All DBs
Position
F:complement(join(1124878..1125364,1125419..1125612,1125686..1125881,1125943..1126348,1126409..1126615,1126674..1126856,1126923..1126941))
Genome map
AA seq 563 aa AA seqDB search
MVCLISDPDWWRQAVVYQIYPRSFADANGDGIGDLKGITARVPYLKALGVDAVWLNPFYP
SALRDGGYDVANYRDVDPKIGTLEEFDEMTAAFQKVGIRVMVDIVPNHSSDDHEWFQAAL
KAGKGSSERERYIFRDGLGPNKDQPPTDWICSFGGSAWSPSGMNDGQWYFHWFDSSQPDW
NWEHPDVKADFLKTLKFWGDRGVSGFRIDVAHGLAKDMSEPLPNWEQLKKMTHQKLTNGN
SALDHPLLDRKEVHDIYKSWREVFNQFNPPLMAVAEAWVAPDQKPLYASSEGLGQTFSFD
ILLCNFDAGEYRQCIKSSLEGSKKSNSTTTWVLSNHDVMRHPTRFGLPNVPNANHATATA
AYNKFLQTKLMDPKVDVEQGLRRAKAATLMILALPGSTYLYQGEELGLQEVIEIPDEERQ
DPIFIRTKGEEIGRDGCRVPIPWHADEKNFGYGSGKHAHLPQPAWFKDYAVNVEEKDPNS
VLSFYRRALGLRKELQVAEELEWVENPNKEVLHFRRPGGWEVIVNIGKDSVDLPKGSILL
SSSSNALKGSKVPGETTVWLKSA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggtctgccttatttctgatcccgactggtggcgccaggcggtcgtctaccagatctat
cctcgttcctttgccgatgccaacggtgatgggattggagacctcaaaggcataactgct
cgtgtgccttacttgaaagcattaggagtggatgccgtttggctgaacccattctatcct
tccgctttgcgggacggtggttatgatgtggccaattacagggatgtcgacccaaagatc
ggaacgttggaagagtttgacgagatgactgctgctttccaaaaggtcggaatccgagtc
atggttgatatagtccccaaccattcaagtgatgatcatgaatggttccaagccgctttg
aaggcgggtaaggggtcatcagagagggaaaggtacattttcagagatggtctcggacct
aacaaagatcaacctcctaccgattggatttgtagttttggtggttctgcttggtcccct
tctggaatgaacgacggtcaatggtatttccactggtttgactcctctcaacccgactgg
aactgggagcacccagatgtcaaagcagattttctgaagaccttgaagttctggggtgac
cggggagtctcaggcttccgaattgacgtggcgcacggccttgctaaagatatgagcgag
cccttgcctaactgggagcagttgaagaaaatgacccatcaaaagctcaccaatggcaac
tccgccttggatcatccccttctcgacaggaaggaggtgcacgacatctacaagtcttgg
agggaagtcttcaaccagttcaatcccccactcatggcggtcgctgaagcttgggttgct
ccagaccaaaagcccctctacgcttcttctgagggtctcggccagaccttctctttcgac
attcttttgtgcaactttgatgctggagagtaccgtcaatgcattaagagttctttggaa
ggaagcaagaagtccaactccaccacgacctgggtactctccaatcatgacgtcatgcga
catcccacccgattcggtctgccaaatgttccaaatgcgaaccatgcaacggctacggcg
gcctataacaagttccttcaaaccaagttaatggatcccaaggttgatgttgagcaaggg
ttgaggagagcgaaggcggctactctcatgatccttgccttgccgggatccacataccta
tatcagggtgaagaacttggcttgcaggaagtcatcgaaattccagacgaggaacgacaa
gaccctatattcatccgaacaaagggagaagaaatcggtcgtgatggctgtcgagttcct
attccttggcatgcagatgagaagaactttggttacggttctggcaagcatgcgcatctt
ccgcagcctgcgtggttcaaagactatgctgtcaatgtagaggaaaaggaccccaacagc
gtattgagcttttaccgacgggctttaggattgagaaaagagttgcaagttgcagaggag
ctcgaatgggtggagaacccaaacaaagaagtcttgcatttccgaagacctggtggctgg
gaggtaattgtcaacatcggcaaagattctgtcgatctaccaaagggttccattcttctt
agttcgtctagtaacgctctcaagggtagcaaagttcccggggagacgactgtctggctc
aagtctgcgtaa

DBGET integrated database retrieval system