KEGG   Cryptococcus gattii: CGB_G1600CHelp
Entry
CGB_G1600C        CDS       T02232                                 

Definition
(RefSeq) succinate dehydrogenase iron-sulfur subunit
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00020  Citrate cycle (TCA cycle)
cgi00190  Oxidative phosphorylation
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
cgi01130  Biosynthesis of antibiotics
cgi01200  Carbon metabolism
Module
cgi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cgi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CGB_G1600C
  Energy metabolism
   00190 Oxidative phosphorylation
    CGB_G1600C
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CGB_G1600C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer2
Motif
Other DBs
NCBI-GeneID: 10188935
NCBI-ProteinID: XP_003195122
UniProt: E6R957
LinkDB All DBs
Position
G:complement(join(362429..362509,362559..362633,362714..362772,362830..362845,362901..363048,363103..363145,363201..363369,363454..363540,363648..363812))
Genome map
AA seq 280 aa AA seqDB search
MVRPATILRSFNAIPSTSRPLAAAARSFHATASAQLATPVEGKEPQIKEFKIYRWNPDVP
NEKPKLQTYKVDLSQCGPMMLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLA
CLCRIPKDTSKESKIYPLPHMYVVKDLVPDLTLFYKQYKSIEPYLKNDNPPAKGEFLQSQ
ADRKKLDGMYECILCACCSTSCPSYWWNQDEYLGPAVLMQAYRWMADSRDSYGAERKEKM
QNSMSLYRCHTIFNCSRTCPKGLNPAAAIAKMKLEMATGE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggtccgccctgccaccatcctccgttctttcaacgctatcccttccacctctagaccg
ctcgccgctgctgcgaggtctttccatgctaccgcttctgctcagctcgccacccctgtt
gagggaaaggagcctcaaatcaaggagttcaagatctaccgatggaaccccgatgtcccc
aatgaaaagcccaagctccaaacatacaaggttgatctctctcaatgtggccctatgatg
ctcgacgctttgatcaagatcaagaatgagctcgaccctactcttactttccgacgatcg
tgccgagagggtatctgtggttcttgtgccatgaacattgacggtgtcaacactcttgcc
tgcttgtgccgaattcccaaagatacctccaaggagtccaagatctaccctcttcctcac
atgtacgtggtcaaggacctcgtccccgatcttaccctcttctacaagcaatataagtct
atcgaaccttacctcaagaacgacaaccccccagcaaagggagaattccttcaaagtcag
gcggacaggaagaagttggacggaatgtacgagtgtattttgtgtgcttgttgctcaacc
tcttgtccttcatactggtggaaccaagatgaatacctcggtcccgcagtgttaatgcag
gcttaccgatggatggctgactctcgagattcttacggcgctgagcgaaaggagaagatg
cagaacagcatgtctctttaccgatgccacactatcttcaactgttctcgaacatgtcct
aagggtcttaaccctgccgccgcgattgccaagatgaagctcgagatggccaccggcgag
taa

DBGET integrated database retrieval system