KEGG   Cryptococcus gattii: CGB_G4660C
Entry
CGB_G4660C        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
  KO
K17770  mitochondrial import receptor subunit TOM20
Organism
cgi  Cryptococcus gattii
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cgi03029]
    CGB_G4660C
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgi02000]
    CGB_G4660C
Mitochondrial biogenesis [BR:cgi03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    CGB_G4660C
Transporters [BR:cgi02000]
 Other transporters
  Primary active transporters [TC:3]
   CGB_G4660C
SSDB
Motif
Pfam: MAS20 Erythro_esteras PMC2NT
Other DBs
NCBI-GeneID: 10189137
NCBI-ProteinID: XP_003195323
UniProt: E6R9R4
LinkDB
Position
G:complement(join(914434..914690,914747..914942,915010..915080,915156..915282))
AA seq 216 aa
MTSISPVKVAGTAAAIAVSGFLGYAVYFDYMRRHSPEFRKSLRKQQKKLSAVAEANAKAE
KEKNAKALRDGFLRIQTEAIPMTPDQQEGYFAEAANQGEQLIAQGEEHYVEAALHFFRAL
RVYGNPGELLAVYQRVVPPPVLDMIIQLIALSTSAATGAGAGARPTAASLETPAPAPASV
EDLDEEKPAKEDAPSPNSASQGSGAEWEKVNQEAQE
NT seq 651 nt   +upstreamnt  +downstreamnt
atgacctctatctctcccgtcaaggttgcgggcactgctgccgctattgccgttagcggc
ttcctcggttacgccgtctactttgattacatgcgacgacactctcccgagttcaggaaa
tctcttcgaaagcagcagaagaagctctctgctgttgccgaggccaacgctaaggctgag
aaagagaagaacgccaaggctctccgcgatggcttcctccgcattcagaccgaggccatc
cccatgactcccgaccagcaagaaggttactttgccgaggctgccaaccagggtgaacag
ctcattgctcaaggcgaggaacactacgtcgaggctgccttgcacttcttcagggctttg
agagtgtacggtaaccctggagaattgcttgctgtctaccaacgagtcgttccccctccc
gtcctagacatgattatccagcttatcgccctctctaccagcgccgctaccggtgcaggc
gcgggtgcaaggcccaccgctgcttccctcgagactcctgcccccgcccccgctagtgtt
gaggaccttgatgaagagaagcctgccaaggaagatgctcctagcccaaacagcgctagc
caggggagcggtgccgagtgggagaaggtcaaccaggaggctcaggagtaa

DBGET integrated database retrieval system