KEGG   Cryptococcus gattii: CGB_G4680C
Entry
CGB_G4680C        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
  KO
K17415  small subunit ribosomal protein MRP21
Organism
cgi  Cryptococcus gattii
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cgi03011]
    CGB_G4680C
Ribosome [BR:cgi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    CGB_G4680C
SSDB
Motif
Pfam: Ribosomal_S21
Other DBs
NCBI-GeneID: 10189126
NCBI-ProteinID: XP_003195322
UniProt: E6R9R6
LinkDB
Position
G:complement(join(917713..917760,917820..918362))
AA seq 196 aa
MSFLFRSTLRASTSRLPIVLPAPASRPLAFLPLPLSRFNSSLSTPPSSSASKPSSPPQNP
INPRFAELTSSLSIPVSSTSKPHAAAAADPTSEDWWMTVSKKSNYNTFSSTKNFHPTKYF
SGRSVELNRGTDFLVAYKRMQGVMRMGNMKKEAKLNEFHEKPSVRRRRLRSERHRRRFKE
MVRTKVQQAVAMRSRA
NT seq 591 nt   +upstreamnt  +downstreamnt
atgtctttcctctttagaagcaccctcagggcgtccacctccaggcttcccatcgtccta
cccgctcccgcttcacgccctctcgctttcctccccctcccgctttcacgcttcaactct
tccctctcgactcctccatcttcatccgcttccaaaccatcatcgcctcctcaaaaccca
ataaaccccagattcgccgagcttacctccagcctctccatccccgtctcttccacttcc
aaaccacacgctgctgccgccgcagaccctacgtccgaagactggtggatgaccgtttcc
aaaaaatccaattacaatactttttcatcgaccaagaatttccaccctacgaaatacttt
tccggaagatctgttgagttgaacaggggtacggactttttggtggcatataagaggatg
caaggagtgatgaggatggggaacatgaagaaagaagccaagttgaacgagtttcatgag
aagcctagtgtgagaagaaggagattgaggagtgaaaggcataggaggagattcaaggag
atggtgaggaccaaggtgcaacaagcagtggctatgaggagcagggcgtag

DBGET integrated database retrieval system