KEGG   Cryptococcus gattii: CGB_G4700C
Entry
CGB_G4700C        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
Organism
cgi  Cryptococcus gattii
SSDB
Motif
Pfam: Prefoldin GnsAB_toxin KIP1 Nnf1 Prefoldin_2 DUF5407
Other DBs
NCBI-GeneID: 10189127
NCBI-ProteinID: XP_003195321
UniProt: E6R9R8
LinkDB
Position
G:complement(join(922107..922127,922196..922250,922302..922409,922466..922567,922621..922757))
AA seq 140 aa
MSVNLSTPSRTTQSQVYSAHLRNALLPELENTRQRLSTVETDIAEYALLKDNLVGLQKEQ
GKEVNTMSEMGAGIWVHTTIPDISVITLDLGFDLHLEMTLADAEEYVKKKLEILKKKRDS
LSQKEEFLVWQIGQFQGAMS
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtctgtgaatctttctacgccttcgagaactacccagtctcaggtctactctgcacat
ttgcgcaacgctctgttgccagaactcgagaacacaagacagcggttgtcaaccgtcgag
actgacattgcggagtatgctttgttgaaagataaccttgttggcttgcaaaaggaacag
gggaaggaggtgaataccatgagtgagatgggtgccggaatttgggttcacacgacgata
ccagacattagtgtgatcacccttgacttagggtttgaccttcatctggaaatgactctt
gccgacgccgaagagtatgtgaagaagaagctcgaaattttgaaaaagaaaagagattct
ttgagccaaaaggaggaattcctggtttggcagattggtcagttccaaggtgctatgtca
taa

DBGET integrated database retrieval system