KEGG   Cryptococcus gattii: CGB_G4710W
Entry
CGB_G4710W        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
Organism
cgi  Cryptococcus gattii
SSDB
Other DBs
NCBI-GeneID: 10189134
NCBI-ProteinID: XP_003195315
UniProt: E6R9R9
LinkDB
Position
G:join(923158..923572,923635..923795,923850..923939)
AA seq 221 aa
MSGPPPIPSKTRPSFTNPFYHNSNASASSTASSPPSYDTHPSHPTQPFRPSATQQLEPVQ
YSSLSSLTKNKPKHTHTSQPASYEYQPDSSKQGYTTHGFESHGQAVNQNVNAGRRLPPMP
SQATTRTPTEPPQRAVHSAPPAPPPRTGSGFQSYIPSGAQSGFDSAAKGVRGAADTVKDG
FYTVANQQRKEQVMSGIGKLGVGAVKLAGKGVYQVGKFATK
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtcaggtccaccacctattccttccaagacaaggccttcttttaccaaccctttctac
cacaattcaaacgctagtgccagctccacggcctcttcaccgccatcctatgacacccac
ccatcccatcccactcaaccttttcgaccatctgccacccaacagttagagccagtccag
tattcttcactctcttctttgacaaagaacaaaccgaagcatacgcatacaagtcaaccg
gctagttacgaataccagcctgactcatcgaagcaggggtatacaactcacggcttcgag
tcacatggtcaggctgtgaatcagaatgttaatgcgggtagaagactgccaccgatgcct
agccaagcgacaacgaggacccctactgaacctcctcaacgtgcagttcactctgcgccc
cctgcaccaccacccaggacaggatctgggttccagagctacattcctagtggagctcag
tctgggtttgactcggccgccaagggcgttagaggcgcagcagatacggtgaaagatgga
ttctacacagtggcaaatcaacagaggaaagaacaggtgatgtctggcatagggaaacta
ggagttggtgctgtcaagctcgctggcaagggcgtgtatcaagtgggcaaatttgctaca
aaataa

DBGET integrated database retrieval system