KEGG   Cryptococcus gattii: CGB_G4720W
Entry
CGB_G4720W        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
Organism
cgi  Cryptococcus gattii
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 10189128
NCBI-ProteinID: XP_003195316
UniProt: E6R9S0
LinkDB
Position
G:join(924457..924538,924593..924603,924669..924814,924869..924886,924952..925252,925307..925756,925816..925824,925877..926010,926066..926192)
AA seq 425 aa
MADSPSPLPPYNNVWTKRAAEADEWLRQHKVVVSATSASVISTFAGFPLDSLKSRLQSSR
EKVSIPRLAADVVREEGIGGLWRGFPLPLITISIVRTISFTIYSSTKRILNSTPLPSEPP
KADHKPTDDARPGNKDGSSRKTPWINIQLGWFSGDNAKDIGITSFLAGAVSGAVVCVGSA
PFELVKVRRQLEYQIYRDSHPELFCNPSAATAGSGYKVAVPGVPPTASFTPPTTLQAVKL
IVNSNGPLGLYIGWRLHFVRDMLGTALYFAEYDVMRYYLGRQKTKIRENGEGGGFGYDVQ
GDVPDWAKAWLPKQAVPFLCGSVAGVSSWALIYPVDAIKTKAQQRALSRLTPRTPAEQFH
RLVRGTDKDNPKPLLSGITRLYRGLGISMIRSMLTHGLLWTLVDAAGSYIDTKPCERYFG
VDVPL
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggcggacagtccatcaccattgccaccgtataataatgtatggacgaaacgagcagcg
gaggcagatgagtggttacgccagcacaaagttgtggtttcggcaacatcagcctctgtc
atctcaacttttgcaggcttccctctcgattctctcaagtctcgactgcagtcatcacgc
gagaaggtatctatacctagattagcagctgacgtcgttagggaagaaggtatcggaggg
ttgtggagagggtttcctttaccacttataacgatatcaattgtccgaacaatatcattt
accatttatagctcgaccaagcgtatccttaattccacacctttacctagcgaaccacct
aaagcggaccataaacctacggacgacgcccgtcctggtaacaaagatggaagcagccgg
aagactccttggatcaacatacagctaggatggttttcgggtgataatgccaaggacata
gggatcacaagttttttagcgggagctgttagtggggctgtagtttgtgtaggaagcgcg
ccgtttgagcttgtcaaggtacggagacagttagaataccagatttaccgtgattcccac
cccgagctcttctgcaatccctctgcagccacagctggttccggctacaaagtagcggta
cctggtgtaccgcccacagcttcattcactcctccaacgacacttcaagcggtcaaactc
atcgttaattccaatggcccactcggcttgtacatcggttggagactccatttcgtccgt
gacatgctcggaacagctttgtactttgcagagtacgatgttatgcggtattatctggga
cgccaaaagacaaaaatcagagagaatggagaaggaggggggtttggctatgatgtgcag
ggagatgtaccagattgggcaaaagcttggttgccgaagcaggctgtaccattcttgtgt
ggaagtgtggctggagtttcaagttgggcgctgatatatcctgttgatgcgataaaaact
aaggctcaacaaagagctttatcacgcttaacaccacgcacacctgctgaacaattccac
cgcttagtacgaggaacggacaaggataacccaaagccattattatctggcatcactcga
ttgtaccgaggacttgggatctcaatgatccgttcaatgctcacacacggactgttgtgg
acgcttgtggatgctgcggggtcctatattgacacgaaaccttgcgaaagatattttgga
gtcgacgtacctttatag

DBGET integrated database retrieval system