KEGG   Cryptococcus gattii: CGB_G4730W
Entry
CGB_G4730W        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
Organism
cgi  Cryptococcus gattii
SSDB
Motif
Pfam: Atg14
Other DBs
NCBI-GeneID: 10189129
NCBI-ProteinID: XP_003195317
UniProt: E6R9S1
LinkDB
Position
G:join(926840..926954,927282..929470,929573..929803,929858..930238)
AA seq 971 aa
MAAQAALDPCIFGSPPSVPTPAKQLQVKKRVVNLVNPAVRFFHKKQFRVITPNSSVLAPS
PAKPLPTPTSSSFFSQLLAVTMSPRRKEPESEPEPEENEESWEKPGEEGELSLVASTGSA
GSIIVDSDKDEEDVKEEESWNGEPQIHCSPLGLPAVLDGNTSKDASYSECELPSVEWHLP
EDISNLLSTKFPEKGSFSVVDPTSTSTIAPSKDLSADRSSFRDALTSEAASESLKHVSME
NRSEEVFWGLHPDESTMSERGKEDTNPTIRCQLLPREEQVSTIEEKYETQESLLPIQPGR
PKTPPYSTSSIFADMSAEQAELTWPLAHRGPDSSSTFHSPTPIQSTEPLKAAPQTPRTTV
GDVTEFYDCTAMVISPSSDSPIATCSTSASLSSLLAQPTKALFEAQTAHANALSTELELY
KDLTEKLRNEVSERDEVLAKLNMRALEAEMLYSQVQDLRKELAVAKTKAEQAEIQAQSAQ
QQALPSLGRNSPTPLMRTRSAALPSDRTMAAEREARDFEIRLAKALADSATISRQLDEVK
KSRDQHALELEEARAELRDKDDREKSRMIKASHPEESEKDGEMEEMREEMEELQRKLREM
EGKEEEVEVLRQELVEVHCQLAEVKDDGDETQVLRAELSSAHHQLDEYELTKADVDALQK
EISHLRHHVGELKQVKAADEEEIEALLGQIAKLEAENREVEDLKYHVGQLKQVKTADEEE
IENLLGQVEKLKGERNQEEEWKNRVEELNRRVDMEGIRRQDVELKLGESLQSTREQLVQA
QSAPTISPMDVRELQSLRIEVNHLKSQSASKDLEIINLQRRKAELKEDREMLNIALDSKQ
QEVELMKRKFGVRGVAGSTPLGASQRTNLDRGTTPPMTNESFLPKTLTRRRSSLAIQTPV
LEYSKRHSLETPLQGNHRHGPQLYPSTKVTSRVMQRSVSKEENTPPSRASAGGSVARYGR
LRTKEREMTLV
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggctgctcaggcggcgctagacccatgtatatttggatcccctccaagcgttccaacg
cctgcaaagcaacttcaagtgaagaagcgagtggtgaacctcgtcaatccagcggtccga
ttcttccacaaaaaacaattccgagtcattactcccaactcttccgtccttgcaccatcc
ccagcgaagccactaccaacgcccacatccagttctttcttctctcagctacttgcagtc
actatgtcacctcgtcgtaaagagcctgaatctgaacctgagccggaggagaacgaagaa
agctgggagaagccaggtgaagagggtgaactatcgttggtcgcctcaactggatcggct
gggagcattatcgtcgacagcgacaaggatgaagaagacgttaaagaagaggagtcttgg
aatggcgagccccaaatacactgctcgcccctaggattacccgctgtacttgacggcaac
acatccaaagatgcctcctatagtgaatgtgaacttccttcggttgagtggcatcttcca
gaagatatatcgaacttgttgtctacaaaattcccagaaaaaggctcattctcagttgtc
gatcctacctcaacctctaccatagctccatcaaaagacttgtctgccgatcgatcttct
tttcgagatgccttaacgtctgaggccgcctccgaatcactgaaacacgtcagtatggag
aataggtccgaagaggtattttgggggttacatcccgacgaatccaccatgtctgagcgt
ggcaaggaggataccaaccccacaatccgatgtcagctacttcctcgtgaagagcaggtc
tctactattgaagagaaatatgaaacccaagagtctcttcttcccattcagcctggacgt
cctaagactcccccatattccacaagttcgatatttgccgacatgagtgcggagcaagct
gaacttacttggccactcgcccatcgcgggccagattcttcttctactttccattcgccc
actcccatccagtccacggaacctcttaaagcagctccccaaacccctcgcacaacggtg
ggagacgttacagaattttatgactgtacagctatggtcatatccccttcctctgattca
cctattgctacttgttctacatcggcatctctttcaagcctcttggcacagcctaccaaa
gctctcttcgaagctcagacagctcatgcaaatgcactcagcaccgaacttgagctttat
aaggatcttactgaaaagctccgcaatgaagtctcagaaagagacgaggtgcttgccaaa
ctaaatatgcgagcattggaagcagagatgttgtactcccaggtgcaagatctgagaaag
gagctggctgttgctaagacaaaagcagagcaagcagagatacaagctcaaagcgctcag
cagcaagcgctgccaagtctaggccgcaactctccgactcccctcatgcgtactcggagc
gctgctctcccttctgataggactatggctgctgaaagagaagcgcgtgacttcgagatc
cgacttgctaaagctttagcggattccgcaaccatctcgcggcagttggacgaagtcaag
aagtctcgcgaccagcatgcccttgagctcgaagaagcccgagctgaactacgggataaa
gatgatcgcgagaaaagccgcatgatcaaggcgtcacaccctgaggagagtgaaaaagat
ggggagatggaggagatgcgagaggagatggaggagttgcaacggaagctacgagaaatg
gagggcaaagaagaggaagtggaagttttgagacaagaattggtagaggtgcattgccag
cttgcggaagtcaaggatgatggcgatgagactcaagttctgagagcggaactctccagt
gctcatcatcagttggatgaatacgagctgacgaaggccgatgttgatgcccttcaaaag
gagatttcccacttaaggcaccacgtcggcgagctcaagcaagtgaaggccgcagacgag
gaggaaattgaagcccttttgggtcagattgccaagcttgaagccgaaaatcgagaagtg
gaggatttaaaatatcatgttggccagcttaagcaggtcaaaacggctgatgaagaagaa
attgaaaaccttttgggtcaagtcgagaagcttaagggggaaagaaatcaggaagaggaa
tggaagaacagggtagaggaactgaacaggagagtagatatggaaggcataagaaggcag
gatgtagagcttaagctaggggagagccttcaatccactcgggagcaacttgttcaagcg
cagtcagcccctaccatttctccaatggacgtgcgggaacttcaatcccttcgcatagag
gttaaccatctcaagtctcaatctgcttcgaaggacttggaaattatcaatcttcaacgg
cgtaaagcggagttgaaggaagatagggagatgcttaatatcgcattggattccaagcaa
caagaggtcgaattgatgaaacggaagtttggagttcgcggagttgctgggagtacgcct
ctcggagcgtcccaacgtactaacctcgatcgaggtaccactcctcctatgacaaacgaa
tctttcctccccaagactctgactcgccgccgatcgtctcttgcgatacagacccctgtt
ctagagtactctaagcgacattcactagaaacgcccttacaaggcaatcatcgccacgga
ccgcagctatatccgagcacgaaagttacatcaagagtgatgcagagaagcgtatctaaa
gaggagaatacaccgccatcacgcgcatctgcgggtggtagtgtagcgagatatggtagg
ttgagaacaaaggaaagggaaatgacactggtgtga

DBGET integrated database retrieval system