KEGG   Cryptococcus gattii: CGB_G4760W
Entry
CGB_G4760W        CDS       T02232                                 

Definition
(RefSeq) ATP-binding cassette (ABC) transporter
Organism
cgi  Cryptococcus gattii
SSDB
Motif
Pfam: ABC_tran ABC_membrane SMC_N T2SSE AAA_29 AAA_22 AAA_24 AAA_33 DEAD cobW MeaB PRK DUF87
Other DBs
NCBI-GeneID: 10189131
NCBI-ProteinID: XP_003195319
UniProt: E6R9S4
LinkDB
Position
G:join(934035..934138,934194..934891,934944..935194,935260..937718,937773..937834,937890..937961,938012..938103,938154..938278,938331..938482,938534..938620,938671..938789,938846..938933,938988..939110,939168..939485,939536..939737,939793..939916,939975..940025)
AA seq 1708 aa
MADSPWVSAASKVISDSSCNKVWDGIDFTSCFREKYLQNAPYFLIAASALYLLSTLPSRR
ARRSQDSLSASTLVSSSYPSDLANLESSVILDSIATNLLPPWFASTPSKPAERLPEGEAE
RVIVDFVKQKRRDVTRWQDLRFWIGLLGAVTWFEVELARAVMQGSWKDVIFPAWLSLISI
ITHSHITPLLSLHSMTSLILFRTLMIHPNPSKLHIACFAVEIVYCIAMLGLPYHENLDRL
LEGAKSKGGGSLGSFGSKLPKHCEEPASAWSRGTYNFMLPLLFKHYLTPITLENIPAIRE
DDSSAGSLGAFRAFSAKRDATYSKKHNGAKRRRNLGLELAMFFAPELGWQILWASVFIFF
QYLPPNGLRLLLQYVKQRETNPQPTHVAVLYVAMMVVGQCMSAITLGQALYLGRRLCIRI
RAIIIAEVFAKALRRRDVSGDVKKSMPTKSTAPAAADGKGNDQAQNLAEGEGTTGEGKIT
NLVSVDAFTISEICAYSYYVVSCPLAIVVNSVLLYQTLGPAAFAGIAVLVAVMPAQYGMS
RLYMSRQKKFMTATDARLESVTEVIAHIKLIKFNAWEGKFFDRMMITREKELRMLARRYA
TAVLFQLLVWSTPVIVTGVAFAVHSLWLKQPLTADKAFASLILFNMLKDPIALAQDTVTR
LIQASTSCSRIQKYLEEPDTLKYRQLSTPGPNEPQIGFKDAVLGYLTPGEAAKLESDQSE
PFNLRGLNVSFPVGKLSVVCGPVGSGKTTLILGLLGETLLLEGQVFMPDDHANRDVCPID
PATGLADTVAYCAQTPWLVGASIKENIIFGSNWDKERYDHVIKACALQRDFEIFELGDET
EVGEKGTTCSGGQKARISLARAFYSSAKTIILDDVLSAVDAHTARHLYEQILQGPLIQGR
TVILVTHQVNMVSPAADMVVMLDNGTVTASGSPSELAASGALDLLEDDSERDEASAGTSV
AAPPTLRAAPGSPVQRDTNIPYIEDQLDSPAEEELAEQQKQVDANRAAQTDETTRLGKQL
VAAETSSQGTVQAATYMLYFKALGGITIWVIVVIVFFGSQMLQVANNAWIKEWANADDRA
ASASLLGKAAFTVYQIVIDAREYIQAEVERKHSTAYYLAIYWAISAFYLIAVVGRVGISF
IGALKASRHMYDRLLQRILGARMRFFDSTPSGRILNRLSKDMSSIDQETGEICMYFANSC
LSAATILVVVTVSTPAFLSALVLICFLYWVIGSLYVATNREIKRIDSVTRSPIFISFTEV
LVGMSTIRSYGDSARFMRKLFHELDQNTRCFWYLWQINRILNNYSNFVGAFVTVFAALFA
LKNKSMDAGAVGLSVSYALSFTEYVLWVVRLYAAVEMSMNSVERVGEYLELEVEEESHEK
GKEPPAYWPTSDGSIIVENLTCRYAPQLEPVLKDVSFTIGPKEKIGVCGRTGSGKSTLAL
SFFRFLFQESGKITIDGEDIAELSLNALRSRLTILPQEAQLFSGTVRDNLDPFDQHEDAD
IWDALAQCGLVGKSRLSSRATSRVQSGADLTSLSSSTTKELNASLVKSVLKKSLKNGEEG
EEGGERVVIRSLEEKVAVGGKNFSQGQRQLLALARGLLKLRNSSFLIMDESTANLDHATD
ATIQNVLRTGLADTQMLVIAHRLMTVAGLDKILVLDHGKVMEYGAPWELMQKEKGIFREL
CKQSGEETQLWEMAKIVHEAKQNASARS
NT seq 5127 nt   +upstreamnt  +downstreamnt
atggcagactccccttgggtctctgcggcttccaaagtcatctccgactcaagttgcaat
aaagtctgggatggtatagatttcacttcatgtttccgcgaaaagtatctccaaaatgct
ccatatttccttatagcagcttccgccctttatcttctctccaccctcccatctcgcagg
gctcgcagatcccaagattccttatcagcctcaactctcgtctcctcctcctacccctca
gatctcgccaacctcgaatctagcgttatccttgattccatcgctaccaatctcctcccg
ccatggtttgcttctaccccttcgaagcccgcagaaagactacctgagggtgaggccgag
cgggtgattgtggattttgtcaagcaaaaaaggagggacgtgacaagatggcaggatttg
aggttttggattggccttttaggtgctgtgacgtggtttgaggtcgaattggcgagggcg
gtgatgcaaggaagctggaaggatgtcatttttcccgcctggttatcccttatctccatc
atcacccactctcacatcactcctctcttgtcattacactctatgacatcgcttatcctt
ttcaggaccttaatgatccacccgaacccttcaaaattgcacattgcgtgttttgccgtg
gagatagtatactgcatcgcgatgctggggttgccataccacgagaatctggataggttg
ttggaaggtgcgaagagtaaaggagggggtagtttgggaagctttgggagcaagctgcct
aagcattgtgaagagcctgcttccgcatggtctcgaggaacatacaactttatgcttccc
ctacttttcaaacactatcttactcccattacgctagagaacatcccagctatccgtgaa
gacgattcatcagctggctctctcggtgcttttcgagctttcagtgctaaacgggacgct
acctactcgaaaaaacataacggtgctaagaggagaagaaatctgggtctcgaactggcg
atgttctttgctcctgaactcggttggcaaattctctgggcgtcagtcttcatcttcttc
caatacctccctccaaacggtcttcgattactcctgcaatacgtcaaacaacgagagact
aaccctcagcccacacacgtagccgtcctctacgtggctatgatggtcgttggacaatgc
atgtctgccattacccttggccaagcactatacctcggtagacgattgtgtatcagaatt
cgagcaatcatcattgctgaagtatttgcgaaagctcttcgaaggagagatgtctctggc
gacgtgaaaaagtctatgcctaccaaatctaccgcccctgctgccgctgatggaaagggg
aatgaccaagcccagaaccttgctgaaggtgaaggtacgacgggtgaaggaaaaatcact
aacctagtctctgtcgatgcgtttaccatctccgagatctgcgcttactcctattacgtc
gtctcctgccctctcgccattgtcgtcaacagtgtgcttctttatcaaaccctcggcccc
gctgctttcgcgggtatcgccgtcttggtggcagtcatgcctgctcagtatgggatgagc
agactctacatgagccgccagaaaaagtttatgacagctaccgacgcaaggctcgaaagt
gtcaccgaggtcattgcccacatcaagctcatcaaattcaacgcttgggagggcaagttc
tttgaccggatgatgattacgcgtgaaaaagagttgcgcatgctcgctcgccgatatgcg
actgcagtcctattccaattgctcgtgtggagtacaccggtaatagtcactggtgtagct
tttgccgtgcatagcttgtggttgaagcagcctctcacggctgacaaggcgtttgcatcg
ttgatcctgttcaacatgctgaaagaccctattgccctcgcccaagacactgtgacaagg
ttgattcaagcgtcaacgtcttgcagtcgtatccaaaagtaccttgaggaacctgacact
ctcaaataccgacagctttccacacctgggcctaatgaaccccaaatcgggttcaaagac
gccgttctcggttacctgaccccgggagaagctgccaaactggaatccgaccaatctgag
ccttttaatctccgcggattgaacgtatccttccccgtcggcaagctgagtgtggtctgc
ggtccagtgggttcaggaaagacgacccttatcctcggtttactcggtgagacactgctt
ctcgagggtcaggtattcatgccggacgatcatgccaacagggacgtttgccctattgac
cctgctaccggacttgctgacaccgtcgcatactgtgcccagacaccttggttggtcggt
gctagtatcaaggagaacattatctttgggtccaattgggataaagagaggtacgaccat
gtcatcaaggcttgtgcgctccagcgagactttgagatttttgagcttggcgatgagaca
gaagtgggagaaaaggggactacctgctctggtggccaaaaggcgcgtatctctcttgct
cgtgctttctactcgtccgcaaagaccatcatcctcgacgacgttctctcagcagtagat
gcccacacggctcgacatctgtacgagcaaattcttcaaggtccactaatccagggtagg
acagtgattctcgtgacacaccaggtgaatatggttagtccagcagcggatatggtcgtc
atgctcgataacgggaccgttaccgcttccggctcaccctcagagttggcagcttcaggt
gcattggacttgttggaagatgatagtgaaagggatgaggcgagcgctggcacgagcgtc
gctgcgcccccgactttgagggccgcacctggttcacccgtccagcgtgataccaatatc
ccgtatattgaagaccaactggactccccggctgaagaagaactcgctgaacaacaaaaa
caagtggacgcaaaccgtgctgctcagacagacgagaccacccgcctcggcaaacagctt
gtagccgccgaaacttcatctcagggcaccgtgcaagctgcaacttatatgctttatttc
aaagccctgggaggtatcacaatctgggtcatcgtggtcattgttttctttggttctcag
atgctccaggtcgcgaacaatgcttggatcaaggaatgggccaatgccgatgacagggcg
gcatccgcttcgctcttgggcaaagcagcattcactgtctatcagatcgtgattgatgct
agggagtacattcaagcagaggtggaacgaaagcattcgacagcgtattatctggcaata
tactgggctatctccgctttctatttaattgctgtggtcggcagggttggtatttctttt
attggagcactgaaggccagtcgacacatgtatgatcgattgttgcagcggatcttgggt
gcgaggatgaggttctttgattctacaccttcgggtcgaattttgaaccgattaagtaaa
gacatgtcctctatcgaccaggaaaccggcgaaatctgtatgtactttgccaactcatgt
ctctcggctgcaaccatcttggttgtcgttactgtatctactcctgctttccttagtgct
ttggtccttatctgcttcttgtattgggtcatcgggtcactctatgtggccactaaccga
gaaatcaaacgtattgatagtgtcaccaggtctcccatcttcatcagtttcaccgaagtc
ctagttggtatgtctaccattcggtcttatggcgatagcgcccgcttcatgcgcaagcta
ttccatgaacttgatcaaaacacacgttgcttctggtacctgtggcagatcaaccggatc
ctcaacaactactccaactttgttggcgcattcgtcactgtctttgctgcgctctttgct
ctcaaaaacaagtcaatggatgctggtgcagtagggttgtctgttagctatgctttgtct
tttactgaatacgtattgtgggtcgtcagactatacgctgctgttgagatgtccatgaac
agtgttgaacgcgtaggcgaatatcttgaacttgaagtcgaagaagagagtcatgaaaaa
ggaaaggaaccgcctgcctactggccgactagcgatggatctatcattgttgaaaatctg
acttgtcgatatgcgcctcagctcgagcctgtcctcaaagacgtttcgttcactattggg
cccaaagagaagataggcgtatgtggtagaaccggtagtggaaagagtactctcgctctt
tcattcttcaggttcttgtttcaggaatctggcaagatcacaattgatggcgaagatatt
gcagaactcagccttaatgcgctcaggtcaagacttactattcttcctcaagaggcccag
ctcttctccggcaccgtacgtgacaacctcgatccatttgaccagcatgaagacgccgat
atctgggatgcacttgctcagtgcggtcttgttggcaaatctcgactctcaagccgcgct
acaagccgagttcaatctggggctgacttgacttctctgagctcctctactactaaagag
cttaatgcctcccttgtaaagagcgtactgaagaagagccttaaaaatggcgaggaaggt
gaagaagggggggagcgggttgtcattagaagtttagaagaaaaggtcgccgtcggtggg
aagaatttcagtcaaggacaaaggcagcttcttgctcttgctcgaggtctcctaaaactc
cgcaattccagcttccttatcatggatgaaagcacagccaacctcgaccacgccacggat
gccacaatccagaatgtgctacgtacgggtttggccgatactcagatgttggtcattgcc
catcgcctgatgactgtcgctggccttgacaagatcttagtgctcgatcatggaaaggtg
atggagtacggtgcaccttgggaactgatgcagaaggaaaaaggcatctttagggaattg
tgtaagcaaagcggagaagagactcagttgtgggagatggccaagatcgtccatgaagcc
aagcaaaacgcctcagctaggtcctag

DBGET integrated database retrieval system