KEGG   Cryptococcus gattii: CGB_G4770C
Entry
CGB_G4770C        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
Organism
cgi  Cryptococcus gattii
SSDB
Other DBs
NCBI-GeneID: 10189132
NCBI-ProteinID: XP_003195502
UniProt: E6R9S5
LinkDB
Position
G:complement(join(940309..940940,940987..942658,942709..943067,943117..943174,943227..943313))
AA seq 935 aa
MAPSGLIISKLGIQATASDTHVRGLICLKISLPRESAGRPGARWVLFNSTPAALLSQPTI
HPLPLPLPSTQSPHLRIASTLLSLPHSTSYPPTPSQPSILGGKPYIDVSSTTGKVFVVVD
SLGGNGRRGSFKGKSNSSGNTEWERKDWLIVVEFRQVLENSIEGGIYKVLLPLPRCLDNV
IRFQILSPSISASSMNQVSVLTEPKMLPLPGSTFNSDPTTYGRELISGKGKDVMREEGWE
DGEDLEDEDYESDDQGSSWLEGRFQRYATLHLSRDMTNALNSTDILRLEWSFTSTMIDPT
TPLLLISPKWDKNRPSMELSYTGIAPGSDTVVSLEVDVPEGWAWAEFIIKSEGLAYWRGV
DGGFESEEREDPDKTAEYRDDNSFATVRPDESAHLHRRNRTRQSIPSSSTAAGPSTTTYL
PPTAGTGSSISLMRQTLPIAGEAMDDFSFEMSSEQSPAPKRPNTPLGSRVSLIPTSKPST
PSERGKPSASIPETKFVKQGKLFDLYFHEHGDRAITLHGVLVPISNLTLVSQQLPCPIPL
VVLHNGPGQCNIQCSNALYQDQTLSTSEPRLISVPSTNAFFWADDSLSNSKRDKENGRMK
GDARIRLRRDIWGVVSMFVLFSFPRRGDEVGFTLYTSNPDTNEYDNDTKGRTIRVIQTSV
DGHPIPRCLHRWQDGKTEVRVGKKEGRNSGLVEIILEMVGQEFSLPIFEDAEGMGLVELC
GEGWEVVKPSMQTTLTPSSNDTYSYSLSTPCSISIRPSSTVSPISTISRARTLFSFSTFF
NLFMLWLLLSMGSQIQRLRNEVSYVAGEARDLRIYGYNPSPVGAGEGREGECLDRTLKDE
EEEEMKGESAVTLGSTHQIPLNDPSSHSSSEELLSGAPPQAPSLHLTTPNALAPHQQHHL
WAGWDKLVMHPTVNSLAKSMAWLWHAVIWLVVPPI
NT seq 2808 nt   +upstreamnt  +downstreamnt
atggcaccatcaggactaattatatcaaagctaggcatacaggctacagcatcggatact
cacgttagaggactaatatgtctgaagatatctttacctagggaaagtgctggaagacca
ggagcaagatgggtgctattcaactcaacacccgcagctctcttatcccagccgaccatc
caccctctgccacttcctcttccatcgacgcagtcgccacatcttcgtatcgcttcaaca
ctactttcactcccacattccacgtcttacccacctacaccttctcagccatctatcctc
ggagggaaaccgtatattgatgtgtcaagtacgactgggaaggtcttcgtagtggtagac
tcacttggtggtaacggaagaagaggaagctttaaaggcaaaagtaatagcagtgggaat
acagagtgggaaagaaaagattggttgattgttgtggagttccgacaggtcttggagaat
agcatagaaggtggaatctacaaggtgctcttgcctcttccaaggtgtttagacaatgtc
atccgctttcaaattctctcgccttccatttctgcttcatctatgaaccaagttagtgtc
ctgactgagccaaaaatgctgccattgccagggtctacttttaattctgatccgaccaca
tatggacgtgaattaatcagcgggaaagggaaggatgttatgagagaggaaggttgggag
gacggggaggacttggaggacgaggattatgagagtgacgatcaagggtctagttggtta
gaaggaagattccagaggtacgccaccctgcatttatcaagagacatgactaacgccttg
aacagcactgatattttgaggctggaatggtcattcacatccactatgatcgaccctacc
accccattactcttgatatcacccaaatgggacaagaatcgaccttctatggagctcagt
tacactggcattgctcctggttcagatactgttgtatccctcgaagtcgacgtccccgag
ggatgggcgtgggctgaatttattatcaagagtgaaggattggcgtattggagaggagta
gatggaggatttgaaagtgaggaaagggaagatcctgacaagacagcagagtaccgcgat
gataattcttttgcgaccgtccgtcctgacgagtcagcacacctacaccgacgcaatcgc
acacgtcaatctatcccttcatccagtaccgctgcaggaccatcgacgaccacgtatctc
ccaccaacagctggcactggctcgtctatcagtctcatgcgacagactttacccatagca
ggagaggcgatggatgacttctcctttgaaatgagcagtgaacaaagtccggctccgaag
agacccaacacgcctctggggtcgagagtatcgttgatacctacgtccaaaccatctacc
ccttcagaacgtggtaagccatctgcatccataccagagaccaagtttgtcaagcagggt
aaattgttcgatttgtactttcacgagcacggcgacagagccatcacacttcacggggtg
cttgtgccaatctccaacctgactctcgtcagccaacagcttccttgcccaatccctctt
gtggttctgcacaacggcccaggacaatgcaacatccagtgcagtaatgctctctaccaa
gatcaaactctctccacgtccgaacctcgtttgatcagcgtaccctctactaacgccttt
ttctgggccgacgattcgttatcaaatagtaagagagacaaagaaaacgggagaatgaag
ggggatgcgagaatcaggctacgtagagatatctggggggtagtttctatgttcgtgctc
tttagcttccctcgtcgaggtgacgaagttgggtttacactctatacttcaaatccagac
accaacgaatacgacaatgacactaaagggaggacaataagagtaattcaaacaagcgtg
gacggccatcccatcccaaggtgtttacatagatggcaagatggcaaaacggaggtgagg
gtcgggaagaaggaagggaggaattcaggtctggtagagattattttagaaatggttggg
caagagttttcattgccgatatttgaggatgcggaagggatggggcttgtggagctttgc
ggcgagggttgggaagttgtgaagcccagtatgcagacaacgcttacaccatcatcaaat
gacacctattcttattccctttcaacgccgtgctcaatctccatccgaccatcttctact
gtttcaccaatctctacgatttcgcgcgctcgaacactcttttccttctcaacattcttc
aacctcttcatgctctggctcttactatctatgggttcacaaatccagagactgagaaat
gaggtctcttatgtcgcaggcgaagcgagagatctgaggatatatggctacaatccatca
ccagttggagcgggtgagggtagggagggtgagtgcctggacaggacactgaaagatgag
gaagaagaggaaatgaagggggagagtgctgttaccttaggttcgacacaccagatcccc
ctcaacgatccgtcctcgcattcctcttctgaagaacttttatcgggggcacctccacaa
gccccgtcattacatctcacgacgcccaacgcactcgcgccgcaccaacagcatcatttg
tgggcaggatgggataagttagtgatgcatccgactgtgaacagtttggcgaagagtatg
gcttggctatggcatgcggtgatatggttagttgtacctcctatctag

DBGET integrated database retrieval system