KEGG   Cryptococcus gattii: CGB_G5020W
Entry
CGB_G5020W        CDS       T02232                                 

Definition
(RefSeq) microtubule motor
  KO
K10398  kinesin family member 11
Organism
cgi  Cryptococcus gattii
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cgi03036]
    CGB_G5020W
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cgi04812]
    CGB_G5020W
Chromosome and associated proteins [BR:cgi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    CGB_G5020W
Cytoskeleton proteins [BR:cgi04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     CGB_G5020W
SSDB
Motif
Pfam: Kinesin Microtub_bd Microtub_bind
Other DBs
NCBI-GeneID: 10189316
NCBI-ProteinID: XP_003195504
UniProt: E6R9S7
LinkDB
Position
G:join(945995..946278,946331..946639,946689..947054,947102..949035,949086..949237,949295..949558,949678..949686)
AA seq 1105 aa
MSRRPTTSRAGMSRTASSASISMPPPSRIPNRPPSVMSVSQPSHERDARDSRASSPPKRM
RKGTGVTMTSRKIEAPGMGINMDGEINIQVVVRCRGRSQQEVDQASPVITTTTGPISKMV
TVETTPLPSATLSTFTTASVYGGTHHPTTKTYPFDKVFGPEADQTMVFNEVAEGMLGEVL
SGYNCTIFAYGQTGTGKTYTMQGDLELTNLDTPKSTAGIVPRVLHSLFNILESQADTEYS
VKCSYVELYNEELRDLLAPEYRGEQSGTGGLKLYEDGKKGTMIQGLEETGVRNLKEALGM
LDKGVKRRQTAETKMNTESSRSHTIFSITVHVKESGMQRGGEDMLRIGKFNLVDLAGSEA
IGRSGATDKRAREAGMINQSLLTLGRVISALVEKGSHIPYRESKLTRLLQDSLGGRTKTC
IVATISPTRSNMEETLSTLDYAIRAKSIRNRPEVNAHLTKTGLLKEYVGDIERLKAELAA
TREKNGIYIPEDQWREMHEVQVKQKSDYDEAKLKASVIEVALDTKKKEFDEVSVRLLATV
DELAQVREAEKQLMEMLDETKIVLDAIQTRLDEETVISQAYMQGEERLDAVAGGLKKVAT
ESVNDVGGLFEKIGRFTISSEFFIHSPLVPARKAKILGSNASAATRFGGELQGLSQNLRN
GLSQLQSAHENFGQEIQIEMETYALKGQQATQHDLAALDRSFVAFNDLSLKLASSNEKGQ
REASDLSKSLLAVKDEVQSSVREWAQGVSDRSKSMVDELLEHQQQHLTAVGSVLDSTASL
VAAIITAAQEHLAAESVSALHARDLAVQTSSSEIARLRSQNVLLAKLLSEEKAKTAKLRT
ELIGNLTSMIESFTDEQDKGWSAVVDKVKMDNEKSVEKMEELDEEARRVWEEGDGRRKLF
ENQVRSGGETAVLQKGEGQMALRQVREGLKERLECYGQETMGEAEVHVEMMDGFCVKMAK
SATSVANKSTARGKKNSEIMEALTKNAKSTHQASQARSSAMADSINSVTSTLLTSRSSSS
ATFSEAYSATESNLNSIIASTADFLQSGIQEDIPTGITPRKKVWNVQAEWERTGPREAVL
ASWRKRQEAVGQPESQSGVVRDELS
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgtctagaaggcctaccaccagcagagcaggaatgtccagaacagcatcttctgcatct
atttcaatgcccccgccatcaaggattcccaatcgaccgccatcggtgatgtcggtatct
caaccttcgcatgagagagatgctagagacagtcgagcttcaagcccaccaaaaaggatg
agaaagggtactggtgttactatgaccagtaggaagatagaggctcctggaatgggaata
aatatggatggagagatcaatattcaagtggtcgtgagatgccgtggacgctcccagcaa
gaggtggatcaagcatctccagtgataaccactaccactgggccgatatcaaagatggtg
accgtcgaaaccaccccattaccgtcagcgaccttgtcaacattcacgacggcgtcagta
tacggtggaactcatcatccaactacaaaaacgtacccttttgacaaggtttttgggcca
gaagccgaccaaacaatggttttcaatgaggttgctgaagggatgctgggagaagttctg
tcaggatacaattgtaccatttttgcctatgggcagactggtactggaaaaacttatact
atgcaaggtgaccttgagctcacgaaccttgacactcctaaatcgacggctggtatcgtt
cccagggtccttcacagtcttttcaacatcctcgaatcccaagccgacacggagtactcc
gtcaaatgctcttacgtagaattgtataatgaagagcttcgagacctcctggcgccggag
tacagaggtgaacaaagtgggactggcggactcaaattgtacgaagatggaaagaagggg
actatgattcagggcctggaagagacaggtgtgaggaacttgaaagaggctttgggcatg
ctggacaagggagtgaagagaagacagaccgctgagacaaagatgaacaccgaatcttcg
cgatcacatacgatcttctctatcacggtccatgtcaaagagagcggaatgcaaagggga
ggcgaggatatgcttcgaatcggaaagtttaatttagtggaccttgctggctcggaagct
attggccgttctggtgccaccgacaaacgcgctcgcgaggccggcatgattaatcagtct
ctcctcaccctcgggcgggtcatctcagcccttgtcgagaaaggcagtcatatcccttat
cgagaatcaaaactcactcgattactgcaagattctctgggtggtagaacaaaaacatgt
atcgtcgcaactatcagtccaacccgatccaacatggaagaaactctctccactcttgat
tacgccattcgcgctaaatctatccgtaatcgaccagaagtcaatgcccatctcacgaag
accggtttgctcaaagaatatgtcggggatatcgagcgtctcaaagcagaactcgctgcg
acaagagagaagaatggaatatacattcctgaggatcaatggcgggagatgcacgaagtt
caggtgaagcagaaatcagattatgacgaggccaaacttaaggcgagcgttattgaggtc
gctttggatacgaagaagaaggagtttgatgaagtcagtgtacggctgcttgcaacggtc
gatgaacttgctcaagtaagggaagctgagaaacaactgatggaaatgcttgacgaaacg
aagatcgtacttgacgctatccagacaaggctagatgaggagacggtaattagccaggct
tatatgcaaggagaggagagactagacgcagttgccggaggcttgaagaaagtggccact
gagagcgtgaatgacgttggaggattgtttgagaagatcggtaggtttacaatttccagt
gaatttttcatccactcacccttagtaccagcccggaaggccaagatactcgggtccaac
gcaagcgcagctactcgattcgggggagaactgcaggggctctcccagaaccttcgtaac
ggtttatcccagctgcagtcagcacatgaaaatttcgggcaagaaatccaaattgagatg
gaaacctatgccctcaaaggacaacaagctacacaacatgaccttgctgctctcgatcga
tcctttgtggctttcaatgacctctccctaaagctcgcttcgtcaaatgagaagggtcaa
cgcgaagcatccgatttgagcaagtccttgttggctgtcaaagatgaggtgcagagttct
gttcgtgaatgggcgcagggtgtaagcgacagaagcaagtccatggtcgacgaactgctt
gaacatcaacaacaacacctcactgccgtcggttcggtactcgactctactgccagtctt
gtcgccgcaattatcaccgccgcacaagaacacctcgcggccgagtcagtatctgctctt
catgcacgggatcttgctgtacagacatcatcatccgaaatcgcccgcctgcgctcccag
aacgtcctcctcgccaaacttctttccgaagaaaaagcaaagacagccaaacttcgtacc
gaacttattggtaatttgacgagcatgattgagagtttcacggatgagcaagacaagggc
tggagcgcggtggtcgacaaggtgaagatggacaatgaaaagagtgttgagaaaatggag
gaattagacgaggaagcgagaagagtatgggaagaaggggatgggagaagaaagttgttc
gagaatcaagtaagatctggtggtgaaacagcagtattgcaaaagggagaaggtcagatg
gctcttaggcaagttcgtgaaggtttgaaagagagactagagtgctatggtcaagaaacg
atgggagaggcagaggtgcatgttgaaatgatggatggtttctgcgtcaagatggcgaag
agtgctacaagtgttgcgaacaaatcaacagctcgaggaaagaagaactccgagattatg
gaagctttaacgaaaaatgcgaaatctacgcatcaagcctcccaagcaagatcctccgcc
atggcggactctattaacagcgttacttctactcttcttacatctcgatcatcatcttca
gccactttttcagaagcctactctgcaactgaatctaatctcaactctatcattgcctcc
actgccgatttcctgcagtccggtattcaggaagatatccctactggtattactccacga
aagaaggtatggaacgtccaagccgaatgggagaggacgggacctagagaagcggttttg
gcgagctggagaaaaagacaagaagcagtgggccaaccagaaagccagagcggagttgtt
agagatgagctctcgtga

DBGET integrated database retrieval system