KEGG   Cryptococcus gattii: CGB_H4700CHelp
Entry
CGB_H4700C        CDS       T02232                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00020  Citrate cycle (TCA cycle)
cgi00190  Oxidative phosphorylation
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
cgi01130  Biosynthesis of antibiotics
cgi01200  Carbon metabolism
Module
cgi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cgi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CGB_H4700C
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CGB_H4700C
Enzymes [BR:cgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CGB_H4700C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA Lycopene_cycl FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 10185749
NCBI-ProteinID: XP_003195850
UniProt: E6RB91
LinkDB All DBs
Position
H:complement(join(1022672..1022813,1022871..1022996,1023052..1023150,1023206..1023562,1023613..1023910,1023958..1024429,1024482..1024696,1024982..1025022,1025095..1025153,1025299..1025403))
Genome map
AA seq 637 aa AA seqDB search
MLALSRTRALARPLRSNLARNYVVASQTARATEAPNFGQKKGYPIIDHEFDAVVVGAGGA
GLRAAFGLAEGGLKTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHMYDTVKGSDW
LGDQDAIHYMCREAPHTVIELEHYGVPFSRTKEGKIYQRAFGGQSLKYGKGGQAYRCAAA
ADRTGHAILHTLYGQSLRHNTNFFIEYFALDLLMQDGECVGVLAINMEDGTLHRFRSHKT
VLATGGYGRAYFSCTSAHTCSGDGNAMAVRAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGYLINSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEKDHIFLQLSHLP
AEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTVDEQGNDKV
VPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACANHIKETLSPNTPHKPMDPELGKK
SIDELDKIRNASGPLPTSQIRLNMQKTMQTDAAVFRTQESLDEGVAKMRDVYKSYDQVGI
KDRSMIWNSDLIETLELRNIMQNAMQTVVSAAARKESRGAHAREDFPDRNDEEWMKHTLS
FQHDPNSPDVELKYRGVIANTLDEAECKPVPPFKRTY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccctctctcgcacaagggccctcgcccgcccccttcgcagcaaccttgcaaga
aactatgtcgtcgcttcccagacagcccgcgctacagaggctcccaactttggccagaaa
aagggatacccaatcatcgaccacgagtttgatgctgtagttgtcggtgctggtggcgcc
ggtttgcgagcggctttcggtcttgccgagggtggactcaaaaccgcctgtatcaccaag
cttttccccactcgatcccacactgttgcagcccagggtggtgtcaacgctgctctcggt
aacatgacagaagacgactggagatggcacatgtacgacactgtcaagggttctgattgg
ttgggtgaccaggacgctatccactacatgtgtagggaggctcctcacacagttattgag
ctcgagcactacggtgtgcccttctcccgaaccaaggagggcaaaatctaccagcgagct
ttcgggggtcagtcccttaagtacggcaagggtggtcaggcttaccgatgtgccgccgcc
gctgaccgaaccggtcacgccattctccacaccttgtacggtcagtctctccgacataac
accaacttcttcatcgagtactttgctctcgatcttctcatgcaggacggcgagtgtgtc
ggtgtgcttgctattaacatggaagatggtaccctccacaggttccgaagccacaaaact
gtcttggctaccggcggttacggccgagcgtacttttcttgtacttctgctcacacctgc
tctggtgacggcaacgccatggctgtgagagcaggtctgcctttgcaagatttggagttt
gtccagttccaccccactggtatctacggtgctggctgtcttatcactgagggttctcga
ggtgagggcggttatctcatcaactctgagggtgagcgattcatggagcgatacgcccct
accgccaaggaccttgcctcccgagacgtcgtttcccgatccatgaccctcgaaatccga
gaaggtcgaggcgtcggtcccgaaaaggaccacatcttccttcagcttagtcacttgcct
gccgaggtattgcacgagcgattgcccggtatctctgaaactgctgctatctttgccggt
gtcgatgttaccaaggagcctatcccagttttgcctactgtccactacaacatgggcggt
atccccaccaagtacaccggtgaagtcctcaccgtcgacgagcaaggcaacgacaaagtc
gttcccggtctttatgctgccggtgaagccgcctgtgtctctgtccacggtgctaaccga
ctcggtgccaactctttgctcgacattgtcgtctttggccgtgcatgcgcgaaccacatt
aaagaaactctttccccgaacactcctcacaaacctatggaccccgagctcggcaagaag
tctattgacgagcttgacaagattaggaatgccagcggtcctttgcccacttcccagatt
aggttgaacatgcagaagacaatgcagactgacgctgccgtcttccgaactcaagaatct
ttggacgagggtgttgctaagatgagggacgtttacaagtcctacgaccaggtcggtatc
aaggacaggagtatgatctggaattccgacctcattgagacactggagcttaggaacatc
atgcaaaacgccatgcagactgtcgtttctgctgctgctaggaaggagtctcgaggtgcc
cacgctcgagaggacttccccgaccgtaacgatgaggaatggatgaagcacactctctcc
ttccaacacgaccccaattcccccgacgtcgagctcaagtatcgaggcgttattgccaac
actcttgacgaggctgagtgcaagcctgttcctcccttcaagcgaacttattaa

DBGET integrated database retrieval system