KEGG   Cryptococcus gattii: CGB_J0580CHelp
Entry
CGB_J0580C        CDS       T02232                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00250  Alanine, aspartate and glutamate metabolism
cgi00410  beta-Alanine metabolism
cgi00430  Taurine and hypotaurine metabolism
cgi00650  Butanoate metabolism
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
Module
cgi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CGB_J0580C
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CGB_J0580C
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CGB_J0580C
   00430 Taurine and hypotaurine metabolism
    CGB_J0580C
Enzymes [BR:cgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CGB_J0580C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 10186755
NCBI-ProteinID: XP_003196360
UniProt: E6RCN4
LinkDB All DBs
Position
J:complement(join(164426..164458,164524..164638,164699..164806,164862..165225,165275..165341,165392..165509,165562..165615,165667..165798,165849..165916,165967..166221,166273..166390,166451..166478,166529..166659,166706..166788))
Genome map
AA seq 557 aa AA seqDB search
MALSQHVDADKLIEECKDHPIKRHLAHKAALYDIPYTSRYEVEDDVPRYSMPSKGVNARA
TYQLLHDELMLDGNPNMNLASFVHTWVPDECNRLIQENINKNLVDQDEYPAAQQIHERCI
SMISHLWHAPKEATAMGTATTGSSEAIMLGGLALKRRWQEKMKAAGKDIHNPGPNIIMGA
EAQVALEKFARYFEVEPRLVPIKPESSYVMDPKDAIKYVDENTIGIFVILGSTYTGAFES
VQDMAQELDRYEAETGISVPIHVDAASGGFVAPFAYPHYRWDFQIPRVHSINASGHKYGM
SSVGVGWIIWRSIEYLPKDLIFELHYLGATDYSFNLNFSRPAHPILAQMFTFLNLGFDGY
KRIIDKDLTVARLISRALEHSGYFTCLSQIHHPKALSEITSSAEHSNIVPAIANAANTVL
HGKMPTLDDAEYYCEGLPVVSFMFTDEIKKKYPNVKQAWIQMQLRSIGWIVPNYPLAPNC
ENTEILRVVVRESLSGDLARKLVHDILQVTEDLLNDAGPSYSMSIATRRHENIDHGKLAG
IDAAHIKQRTTTYAKPC
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggccctctcccaacacgtagacgctgataagctcattgaagaatgcaaagaccaccct
atcaaaaggcatcttgctcataaggctgccctttatgatattccttacacctcccgctac
gaagtggaagatgatgtcccgcgatacagcatgcccagcaagggtgtcaacgctagagct
acctaccagctcttgcacgatgaactaatgcttgacgggaaccccaacatgaatttggct
tcatttgttcacacttgggtgcctgatgaatgcaaccgtctcatccaggagaatatcaac
aagaatttggttgaccaggacgaataccctgccgctcaacagatccatgagcgatgtatc
tcaatgatctcacacctctggcacgctcccaaagaagccacagccatgggtacagctacc
accggttcctcagaagccatcatgcttggtggtctcgctctcaagcgccgatggcaggaa
aagatgaaggctgctgggaaagatatccacaacccggggccaaatatcatcatgggtgcg
gaagctcaagtagctttggagaagtttgctagatactttgaggttgagccaaggcttgtg
cctattaagcctgagtcgagttatgtgatggaccctaaggacgccatcaagtacgtcgat
gagaacactattggtatctttgttattttgggatcaacttatacaggcgcgtttgaatcc
gtacaagacatggcccaagagctcgacaggtacgaggcggagacgggtatcagtgtccct
atccacgttgatgccgcttccggtggttttgttgctccgtttgcataccctcattaccgg
tgggacttccagatccctcgagtccatagtatcaatgcctctggtcacaagtacggtatg
agctctgtgggtgtcggatggatcatttggaggtctattgagtatctccctaaagacttg
atctttgagctccactatctcggtgctaccgactattcgtttaacctcaattttagtaga
ccggcacaccctatccttgcccagatgttcactttcttaaacctcggtttcgatggttac
aagcgcatcatagacaaagatctcaccgtagctcgtctcatctcccgagccctcgaacac
tctggctatttcacctgtctctcccagatccaccaccccaaggctcttagcgaaatcacc
agcagcgccgaacattccaacattgtccctgccatcgcgaacgccgctaataccgtcttg
catggcaagatgcctacccttgacgatgccgagtactactgcgagggtttacccgttgta
tcgttcatgtttacggatgaaattaagaagaagtaccctaacgttaagcaagcgtggatc
cagatgcagctgaggtctatcggctggatcgtcccaaactatcctctcgctcccaactgc
gagaacaccgagattctccgagtcgtcgtccgagagtccctttctggcgacttggctagg
aagctcgtccacgatattcttcaggtgactgaggatctcctcaatgatgctggaccttca
tattccatgtctattgctactaggcgtcatgagaatattgaccacggcaagctcgctggt
attgatgctgcccacatcaaacaacgcaccaccacgtatgctaagccttgttag

DBGET integrated database retrieval system