KEGG   Cryptococcus gattii: CGB_L1360CHelp
Entry
CGB_L1360C        CDS       T02232                                 

Definition
(RefSeq) alpha-glucosidase precursor
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00052  Galactose metabolism
cgi00500  Starch and sucrose metabolism
cgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CGB_L1360C
   00500 Starch and sucrose metabolism
    CGB_L1360C
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CGB_L1360C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 10185501
NCBI-ProteinID: XP_003197000
UniProt: E6RER4
LinkDB All DBs
Position
L:complement(join(303566..303819,303878..304275,304327..304455,304514..304626,304678..304732,304784..304827,304879..305199,305250..305326,305383..305461,305521..305609,305661..305763,305829..305879,305935..306023,306075..306083,306214..306233,306292..306472,306526..306599,306648..306729,306780..306808,306863..306921,306974..307470,307525..307690))
Genome map
AA seq 972 aa AA seqDB search
MALLLQVFTFLLPILAGATPAYRPATLESFQPRDYSSWAVASQQPDFSGDVTQCKGYAIN
SDSITRTSTGGISAQLDLITYCSAYGKDISSLTLSVEYETSSRLHVHIYDTPVKQFQIDD
SILPRPKRTLFGTDSADKSDLKFDYENSPFAFWVTRKSDGEVLFDTRKDGIPIHEDPSDI
LGTPSNYTVMPAHPLVFEDQYLQLSSKLPVEANIYGLGEAVSGSGYRRNSSSTVQTMWAR
DIADPVDENLYGTHPFYMEVRYNETSCILASHGVFLRNSNGMDVILRDGAIQYRVIGGTL
DLYFVSGPSPNDVTEQYVSTIGLPQPMPEWSFGFHLCRWGYTSANETLSVVNRMRDAGIP
LETQWNDIDWMRSYREFQFDQNYDEADYRNLVETLHSRNQHYIPIIDAAIGHPLNATDRF
DVYDKGHELGVWMRNPDGTEYVGAVWPTFAVFPDWFHPKMQEIWTEAFYNLSQIVDFDGI
WLDMNEPSSFVDGSASNSTMSLENTTVVPPDYSTVPFPTSWPEGYSNVTGISGNVTVDGA
LTYGADGNATKNTALRRSNLVRGDDVLTIPYVDVPPYPINNGNGRLSAKTVSPNATHYGG
LQEYNVHNLWGFMEEEATNNMFLDLRPGKRPFLVSRSTFSGSGRKTAHWLGDNFSTFAYM
KRSIQGVLQFNLFGIPMVGPDVCGFNGNTDEELCNRWMQLGAFFPFFRNHNIKSAISQEP
YVWDSVRDASIKAIKARYQMLPYWSTLFAKASHAGTPAVIPLFHEFPSPSYLDNDYQFLI
GPSVLVTPVLQPNESTVVGQFPTAHDVFWVDWWTHCKLDTSSGEDVTLDLPLGNIGVHVR
SGSALLLYDEPGYTVKETKDSGYAILVVLDGKGYAEGDAKIDDGESLPVTEQTCLTFTST
DSCKLSSTANGSYSIAGKLKTITIVGVWIKPSEVTFNGSKINDSQIEFDEDVGRIKITRL
VEDLNSAWELTW
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atggctcttttattacaagtcttcacgttccttctccccatattggcaggagccactcct
gcatacaggcctgctacccttgagtcctttcaaccccgagattacagcagctgggccgtc
gctagtcagcaacctgacttctcgggtgatgtcacacagtgcaagggctacgccattaat
tctgattccatcacgcgaacatccacaggcggtatttctgctcagctcgacttgatcact
tactgttccgcgtatggcaaagacatttcatctcttaccctttccgttgagtatgagact
tcatcacgactgcatgtccacatctatgacactcctgtcaaacaatttcagattgatgac
agcatcttacctcgcccgaaacgaaccctctttgggacagatagtgccgacaaatcggat
cttaagttcgactacgagaacagtccttttgctttctgggtcactcggaagtcagatggc
gaggtcttatttgataccagaaaggacggtatccccattcatgaagacccttcagacatc
ttgggcactcctagcaactacacggtcatgcctgcccatccgctcgtctttgaggatcaa
tatctgcagttgagctccaaattgccagtcgaagcgaacatctacggcttgggagaagct
gtttctggaagtggctaccgcagaaactcgagctccaccgtgcagactatgtgggcaaga
gatatcgctgaccctgtcgatgaaaacctctacggtactcatcccttttacatggaagtg
aggtacaacgaaacctcctgcatccttgcttcacatggtgtattccttcgaaattcgaat
ggtatggacgttattctccgagatggtgctattcaataccgagtcattggcggtacactc
gacctctacttcgtctccggtcccagccctaacgatgtaaccgaacaatacgtatccacc
atcggccttccacaacccatgcctgaatggtcctttgggttccatctttgtcgatggggt
tacacttctgccaacgagaccctctcggttgtcaataggatgagagatgctggaattcct
ttggagacacaatggaatgacattgactggatgaggagttacagagaattccaatttgac
cagaactatgatgaggccgattaccgaaacttagtggagactcttcactctcgcaaccag
cactacattcccataatcgacgcggctatcggtcatccgctcaatgctacggataggttt
gatgtatatgacaagggtcacgagcttggagtttggatgaggaatcctgatggtactgag
tacgtcggtgctgtctggcccactttcgccgtcttcccagactggttccatcccaagatg
caggagatctggacagaagcattctacaacctctcccagattgtcgattttgacggtatc
tggcttgatatgaatgaaccatcatctttcgttgacggttctgccagtaactctactatg
tctttggagaacaccacggtcgtcccacccgactactctaccgtcccgttccctaccagc
tggcctgaaggttattctaatgtgactggaattagcggtaacgtcactgtggatggcgcc
ctcacttacggtgcagatggcaatgccaccaagaacaccgctctccgtcgttccaacctc
gttcgtggagacgatgttctcaccattccttatgttgacgtccctccctatcctatcaac
aacggtaacggaagattatccgccaagacagtcagccccaatgctacccactatggcggt
cttcaagagtacaatgttcataatctttggggtttcatggaagaggaggctacaaacaac
atgttcttggacttaaggcctgggaagaggccattcctggtctctcgatctaccttttct
ggcagtggtcgaaagaccgctcattggctcggtgacaacttctccacttttgcctacatg
aagaggtctattcaaggtgtcttacagttcaacttgttcggtattcccatggttggccct
gatgtctgtggcttcaatggcaacacggatgaagagctttgtaatcgatggatgcaactt
ggtgctttcttcccatttttcaggaaccataacatcaagtccgcaattagccaggagcct
tacgtgtgggactctgtccgtgatgccagtattaaggctatcaaggctagatatcagatg
ctgccctactggtccacgctattcgctaaggcctctcatgctggaactcctgccgttatt
cccctcttccacgagttcccctcccccagctaccttgacaacgactaccagttcctcatt
ggtccctctgtacttgttaccccagtacttcaacctaacgagtcaactgtggttggtcaa
ttccccaccgctcatgatgttttctgggttgactggtggactcactgtaaactggacact
tcttctggcgaagatgttactctcgatttgcctctgggaaacataggtgtgcacgtcagg
agtggcagtgctttgttgctctacgacgagcccggttatactgtgaaggagacaaaagat
agtggttatgctattttggtcgtacttgatggcaaaggttacgcagaaggtgatgccaaa
attgatgatggtgaaagtttgcctgttaccgagcagacttgcctcacattcacttccacc
gattcctgtaaactctcttccacagctaatggtagctacagcattgctggcaaactcaag
actattactattgttggtgtttggattaaaccttccgaagtcaccttcaatggtagcaag
atcaacgatagccagattgagtttgacgaagatgttggcagaattaaaatcacaaggctc
gttgaggaccttaattctgcttgggagcttacgtggtaa

DBGET integrated database retrieval system