KEGG   Cryptococcus gattii: CGB_L1450CHelp
Entry
CGB_L1450C        CDS       T02232                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00010  Glycolysis / Gluconeogenesis
cgi00051  Fructose and mannose metabolism
cgi00052  Galactose metabolism
cgi00500  Starch and sucrose metabolism
cgi00520  Amino sugar and nucleotide sugar metabolism
cgi01100  Metabolic pathways
cgi01110  Biosynthesis of secondary metabolites
cgi01130  Biosynthesis of antibiotics
cgi01200  Carbon metabolism
Module
cgi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cgi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGB_L1450C
   00051 Fructose and mannose metabolism
    CGB_L1450C
   00052 Galactose metabolism
    CGB_L1450C
   00500 Starch and sucrose metabolism
    CGB_L1450C
   00520 Amino sugar and nucleotide sugar metabolism
    CGB_L1450C
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CGB_L1450C
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cgi04131]
    CGB_L1450C
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CGB_L1450C
Membrane trafficking [BR:cgi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CGB_L1450C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 10185505
NCBI-ProteinID: XP_003196995
UniProt: E6RES3
LinkDB All DBs
Position
L:complement(join(330925..330971,331057..331180,331247..331463,331533..331690,331743..331798,331862..331904,331978..332172,332228..332316,332372..332394,332445..332461,332517..332607,332659..332819,332878..332897,332953..332959,333010..333092,333145..333189,333247..333277,333331..333597))
Genome map
AA seq 557 aa AA seqDB search
MSETPDQLASRVQNLSTGATATHRTPSASVVLENGTNTGSTAGRKASIPAQAVGLESASA
TGSGRVSRRGSGLVMTPGGVQTVYHTRTNEDIEFPHAEKKTMADLLRKYESLFTLTPQRM
RMIVHAIEENLDNGLQKNGQVVPMLPTYVFGWPTGDEVGDFLALDLGGTNLRVCLVTLLG
RGKFEVTQTKYRLTEEQKQDDGQALLDFCAECLDSFVRDTLGRTEKDGILPLGFTFSYPC
SQERIDHGVLIRWTKGFGASNIEGYDVAAMFKDSLKRLNVPAELTALINDTTGTLIASNY
VDPHTKIAVIFGTGCNAAYMETAGSIPKIDYVGLPKEQGMAINCEWGAFDSFDHQHLPRT
KYDIIIDESSNKPGEQSFEKMIAGLYLGELFRLVVCELIDSGDLFLGQNTYKLEKAYAFD
TAFLSLMEADVTDELLTVIGVFTHFFGIETTLEERQFFKKLAVLIGTRSARLSACGIAAI
VSKMGYLEEGCAVGADGSLYNKYPNFADRVHEALSDIFGESGKKIVTHHAEDGSGVGSAI
IAAMTKARKDSGYFVEY
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaacccctgatcagctcgcaagccgcgtccagaacctcagcaccggcgccaca
gccacccacaggaccccctcggcctccgtcgttttggagaatggtaccaacactggctcc
actgccggccgcaaggcctccatacctgctcaggccgtcggtctcgagagcgccagcgcc
accggcagtggccgagtcagcaggagaggcagtggcttggtgatgactccaggaggtgtt
caaacggtgtaccacaccagaacaaatgaggatatcgaattccctcatgctgagaagaag
actatggcggaccttttgaggaagtatgaaagccttttcaccctgactccccagaggatg
aggatgatcgtccatgccattgaagaaaaccttgataacggtttgcagaagaacggtcaa
gttgtgcctatgcttcctacttatgtctttggctggcccaccggtgacgaagtcggagac
ttcctcgctctcgacctcggtggtaccaaccttcgagtctgtctcgtcactcttctaggc
cgtggaaagtttgaagtcactcagaccaagtaccgattgaccgaggaacagaagcaagac
gatggacaagctctcttggacttttgcgcagagtgtttagacagcttcgtccgcgatacc
ctcggccgcactgaaaaggacggtatcctcccgcttggtttcactttctcatacccttgc
tctcaagagcgaattgaccacggtgttcttatccgttggaccaagggctttggtgcctcg
aatattgaaggatatgatgtcgccgccatgttcaaggacagtcttaagcgattgaatgtc
cccgccgaactcactgctctcatcaatgacaccaccggtactcttatcgcctccaactat
gttgacccccacaccaagattgccgtcatctttggaaccggctgcaacgctgcctacatg
gagaccgccggcagcatcccaaagatcgactacgtcggattacccaaggaacagggaatg
gccatcaactgtgaatggggagcgttcgactctttcgaccaccaacaccttccccgaacc
aagtacgatatcatcatagacgagtcttccaacaagccaggagagcagtcctttgagaag
atgattgccggcctttacctcggtgaactcttccgactcgtcgtttgcgagctcatcgac
tctggtgatcttttcttgggtcagaacacctacaagctcgaaaaggcctatgctttcgac
accgctttcttatccctcatggaagccgatgttaccgacgaacttttgaccgtcatcggc
gttttcactcacttctttggcattgaaactacccttgaagagcgtcagttctttaagaaa
cttgctgtcttgatcggtactcgatctgctagactttctgcttgtggtatcgccgccatt
gtcagcaaaatggggtacctcgaggaaggatgcgccgtcggcgccgatggaagtttgtac
aacaaataccccaactttgcggaccgagttcatgaggcccttagtgacatttttggtgaa
agcggcaagaagattgtcacccaccatgcggaggatggttcaggtgtcggtagtgcaatt
attgccgcaatgacaaaggccagaaaagactctgggtactttgttgaatactaa

DBGET integrated database retrieval system