KEGG   Cryptococcus gattii: CGB_M3440CHelp
Entry
CGB_M3440C        CDS       T02232                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cgi  Cryptococcus gattii
Pathway
cgi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cgi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CGB_M3440C
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgi02000]
    CGB_M3440C
Enzymes [BR:cgi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CGB_M3440C
Transporters [BR:cgi02000]
 Other Transporters
  Pores ion channels [TC:1]
   CGB_M3440C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 10186310
NCBI-ProteinID: XP_003197386
UniProt: E6RFJ7
LinkDB All DBs
Position
M:complement(join(654913..654979,655043..655103,655178..655436,655500..655566,655623..655777,655830..655886,655941..655958,656025..656129))
Genome map
AA seq 262 aa AA seqDB search
MPMPDEHIHPTATGLAKKVVDAHQDRQDLVFWSGWFCPFNQRIWIALEERKIPYQYHEVN
PYKKEEAFLKLNPLGLVPTLEIKTPDGSKSLYESDVLAEFLEDLYPPSKEHPSIFPSDPY
EKSWVRLNIQHVTKKIIPNYFKLQQAQTESDQDAARKELISALRTYAKRVKGPYFAGEQW
TAVDGALAPFIRRLYILEKHRNFDEKEVGEGWWEYRERLMARDSLKNTSSEDQYYEEILG
RYLKNEAQSEVAKATRAGQSLP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgcctgatgaacacatccacccgactgccacaggccttgctaagaaggtcgtg
gacgctcatcaagatcgccaagacttagtattctggagcggatggttctgccccttcaat
cagcgtatctggattgcccttgaggaacgaaagataccttaccagtaccatgaagtaaac
ccatacaagaaggaagaggcattcctcaagcttaatcctctagggcttgtgccaacactc
gagatcaaaactcccgacggcagcaaatcgctttacgagagtgatgtcctggcagagttc
ttagaggatctttaccctcccagcaaggagcatccgtccatcttcccttctgatccgtac
gagaagtcatgggtcagactcaacattcagcatgtcaccaaaaaaatcatccccaactac
ttcaaactccaacaagcccaaactgaatcagatcaagatgccgcccgcaaagaactcatc
tccgctcttcgtacatatgccaaacgcgtcaaaggtccttattttgcaggcgaacagtgg
acagccgtagacggagcactggcaccgtttatcaggaggctgtatatccttgaaaagcat
aggaacttcgatgagaaggaggtcggggaagggtggtgggagtatagggagaggttgatg
gctcgcgattcgctcaagaatacttcttcagaggatcagtattacgaggaaatcttggga
aggtacctcaagaatgaagctcaatcagaagtcgccaaggctactcgtgctggccagagt
cttccctaa

DBGET integrated database retrieval system