KEGG   Corynebacterium glutamicum ATCC 21831: AR0_02965Help
Entry
AR0_02965         CDS       T03361                                 

Definition
(GenBank) PucR family transcriptional regulator
  KO
K09684  PucR family transcriptional regulator, purine catabolism regulatory protein
Organism
cgj  Corynebacterium glutamicum ATCC 21831
Brite
KEGG Orthology (KO) [BR:cgj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cgj03000]
    AR0_02965
Transcription factors [BR:cgj03000]
 Prokaryotic Type
  Other transcription factors
   Others
    AR0_02965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PucR HTH_30 HTH_8 Robl_LC7 HTH_23 HTH_17
Motif
Other DBs
NCBI-ProteinID: AIK86994
LinkDB All DBs
Position
complement(581214..582728)
Genome map
AA seq 504 aa AA seqDB search
METPTQDMDVRWLYTQSQLKLRQILPTNKTFDVIQISELVDPTDFISPNSVVLSVGIAFA
ETPDGLRDWAHRLADAGVIAIGFGSGLTFPQVPQALIDASLHLGLGLFEVPREIPFISIT
SSVRDEQTRRAGRLQQELLLEQERLYSIAISGGIEALCRAAADYLGGAVAIVDSDGRVAC
SITTDDLDALPQAVSRLNGSSKALTDATNFGFIHRMTRYGDRHHVLSVLMPTRPSEQHRA
LIRHCAGLADILLQRPEAMRDREIEVRSLAISLLLGRSDDLATIHRVFADITDASGNIRP
ILITGNTPQSVRKALSSVATALYKQERALAHLRLAESTELLFLRGSRSVHNIVQLFGTAA
SGVRLCIGLPTRVENIDKKLIRELTATAKTLQLGTHAEPRDGTLLWLQNPELRKILKIRS
RDTYDRLLDHDRTNNTELAPTLVSFTQHGGHIGDTAKELGIHRHTVRTRMIRIEEICEID
LNDPLTRAELLLVIATKEGDVEKH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccccaacccaagacatggatgtccgctggttatacacccaaagccagctcaaa
ctccgccaaattctccccacaaacaaaaccttcgatgtcatccaaatcagcgaactcgtt
gaccccaccgacttcatcagccccaacagcgtggtcttatccgtcggcatcgccttcgca
gaaacgcccgacgggcttcgcgattgggcacaccgactcgccgacgcaggggtcatcgcg
atcgggttcggctccggcctcaccttcccacaggttccgcaggcgcttatcgacgcctcc
ctccaccttggcctcggcctctttgaagtcccccgtgaaattccatttatctcgatcacc
tccagcgtgcgtgatgaacaaacccgccgtgccggccgcctgcaacaagaactcctcctg
gaacaggaacggctttactccatcgccatctccggtggcatcgaagccctgtgccgtgct
gccgccgactatttgggtggtgcagtagccatcgtggacagcgacggccgcgtggcttgc
tctattaccaccgatgacctagacgcactcccccaagctgtctcgcgccttaacggatcc
agcaaagcactgacagatgccaccaactttggattcatccaccgcatgaccaggtacggc
gaccgccaccacgtgctctcagtccttatgcccacccgccccagcgaacaacaccgcgca
ctgatcagacactgcgcaggccttgccgatattttgcttcaacgccccgaagccatgcgc
gaccgagaaatcgaagtgcgctcacttgccatatcactacttctgggtcgaagcgacgac
ctagccaccattcaccgcgtgttcgctgacatcactgatgcttccggaaatatccgcccc
atcctcatcaccggcaacacaccccaatcagtacgaaaagcactctccagtgtcgccacc
gcactgtacaaacaggaacgagcactagctcatctacgcctcgccgaatccaccgaactc
ctcttccttcgcggaagccgcagcgtgcacaacatcgtgcaactttttggtactgccgca
agcggagttcgcctctgcattggtctgcccacccgagtggaaaacatcgataagaaactc
atccgcgaactcaccgccaccgcaaaaaccctacaacttggaacccacgccgaaccccgt
gacggcaccttgctgtggctccaaaaccccgagctgcgcaaaatccttaagatccgatcc
cgcgacacctacgaccgtctcctcgaccacgaccgcaccaacaacaccgagctcgccccc
accttggtgtcttttactcagcacggcggacatataggcgacaccgccaaagaactgggc
atccaccgccacaccgtgcgcacccgcatgatccgcattgaagagatctgcgaaatcgac
ctcaatgatccactgaccagagcggagctgctcttagtgatcgcaacgaaggagggagac
gtcgaaaagcattaa

DBGET integrated database retrieval system