KEGG   Corynebacterium glutamicum ATCC 21831: AR0_03055Help
Entry
AR0_03055         CDS       T03361                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cgj  Corynebacterium glutamicum ATCC 21831
Brite
Translation factors [BR:cgj03012]
 Eukaryotic Type
  Elongation factors
   AR0_03055
 Prokaryotic Type
   AR0_03055
Mitochondrial biogenesis [BR:cgj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AR0_03055
Exosome [BR:cgj04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AR0_03055
  Exosomal proteins of breast cancer cells
   AR0_03055
  Exosomal proteins of colorectal cancer cells
   AR0_03055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIK87012
LinkDB All DBs
Position
607662..608852
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPELNEAFAFDSIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQDYDEDAPIVHISALKAL
EGDEKWGKQILELMQACDDNIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGTLNV
NDDVDIIGIKEKSTSTTVTGIEMFRKLLDSAEAGDNCGLLLRGIKREDVERGQVIVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtaccaagccccacgtaaacatcggcaccatcggtcac
gttgaccacggtaagaccaccaccaccgcggctatcaccaaggttctggctgacgcttac
cctgagctcaacgaggctttcgccttcgactccatcgataaggctcctgaggagaaggag
cgtggcatcacgatcaacatctcccacgttgagtaccagaccgaaaagcgccactacgca
cacgttgacgctccaggccacgccgactacatcaagaacatgattaccggcgctgctcag
atggacggcgcaatcctcgttgttgcagctaccgacggcccaatgccacagacccgtgag
cacgttcttcttgctcgccaggttggcgttccttacatcctcgttgctcttaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggaagttcgtgaacttctt
gctgagcaggactacgacgaagatgctccaattgttcacatctccgctctgaaggctctt
gagggcgacgagaagtggggcaagcagatccttgagctcatgcaggcttgcgatgacaac
atccctgacccagttcgtgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggtcgtggcaccgttgttaccggtcgtgttgagcgcggtaccctgaacgtg
aacgatgatgttgacatcatcggcatcaaggagaagtccacctccaccaccgttaccggt
atcgagatgttccgtaagcttcttgactccgctgaggctggcgacaactgtggtctgctt
ctccgtggtatcaagcgcgaagatgttgagcgtggccaggttatcgttaagccaggcgct
tacacccctcacaccgagttcgagggctctgtctacgttctgtccaaggatgaaggtggc
cgccacaccccattcttcgacaactaccgtcctcagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttccagagggcaccgagatggttatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgagggcctgcgtttcgctatccgc
gaaggctcccgcaccgttggcgctggtcgtgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system