KEGG   Corynebacterium glutamicum ATCC 21831: AR0_06230Help
Entry
AR0_06230         CDS       T03361                                 

Definition
(GenBank) ABC transporter permease
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
cgj  Corynebacterium glutamicum ATCC 21831
Pathway
cgj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cgj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AR0_06230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgj02000]
    AR0_06230
Transporters [BR:cgj02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    AR0_06230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_16 SMC_N CbiA AAA_22
Motif
Other DBs
NCBI-ProteinID: AIK87618
LinkDB All DBs
Position
complement(1278484..1280040)
Genome map
AA seq 518 aa AA seqDB search
MNTLVKLRSRELIPAVVAGSVTMIASITLTVVSAWLITKAWEMPPVMDLTVAVTAVRALG
ISRAVFRYIERIVSHDLALKAASRARSSAYQRLASSPNSALTMRRGELLSRLGADIDSVA
DVIVRAIIPAGVALLTGVVAIIFTAILSPATALVLAIGLIAAAIIPPLLAARGVKTAEAR
RAESSEAYLSSLDQVLSNQAALRVRGDMPLALSTADVAARSYSSSLEAGAKDTAIGAASS
LWIHGFTVIGVLMVSASLYVDGTHSPQWFGVLVLLSLAAFEAVSVLPDAAIARTRAADAT
RRLAEISALPESASSELREASDQPVLRAENLVYGWDSDLGTSNLDLPFGSRHEIIAPSGT
GKTTLLLTLAGLLEPRGGQVLIDGTNPSELKNAVLFSPEDAHIFATTVRDNLALGAPEAT
DEEMTSILEHVGLSEWVQGLPDGLGTVLDSGADSLSGGQRRRLLLARVLLSDAPILLLDE
PTEHLDTAGSSEILSMLASDELPGKRARRTVVIVRHVR
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccctggtaaaacttcgttcccgcgagctaattcccgccgttgttgcaggtagc
gtgacgatgatcgcctccatcaccctgacggtggtgtcggcctggctgatcaccaaagct
tgggaaatgccgccagtgatggatctgaccgtcgcggtcaccgctgtgcgcgccctgggc
attagccgtgcggtgttccgttatatagagagaatcgtttcgcatgacttggcgttgaag
gcagccagccgagcccgttcgagtgcatatcaacgcctggcttcgtcgccaaactctgcg
ttgacgatgcgccgcggcgaactgcttagccgcctcggtgcggatatcgattcggttgcc
gatgtcatcgtccgcgccatcatccccgccggagttgccctgctcaccggagttgtcgcg
atcattttcaccgcgattctcagccccgcaacagcacttgtcctggcgattggattgatt
gctgctgcaattatccctcccctgcttgctgctcgcggagttaaaacagccgaagcccgg
cgcgctgaatccagcgaagcctacttgagttccttggatcaggtgctgtccaaccaggcg
gcgcttcgtgttcgtggtgatatgcctttggctctgtccactgcggatgtagctgcgcgt
tcctattcctcatcattggaggctggcgcgaaagacactgcgatcggtgcagcgagttcc
ctgtggattcacggcttcaccgtcattggtgtgctcatggtttccgcgtcactatatgta
gatggaacccattcaccgcagtggtttggtgtgttggtgctgctttcactcgcagctttc
gaggctgtctctgttctccccgatgctgcgattgctcgtacccgcgcagcagatgccacc
agaagacttgcggaaatctcggcgctgccagaatctgcgtcttcagaacttcgcgaggcc
tctgatcagccagtcctgcgcgccgagaatctcgtttatggatgggacagcgacctaggc
acgagcaacctggatctcccctttggttcacgacatgaaatcatcgcgccctctggaact
ggcaaaacgaccctgctgctcacacttgcggggctgttggaacctcgtggaggccaagtg
cttatcgacggcacaaatccttccgagttgaaaaacgccgtgctgttcagtccagaagat
gcccacatttttgccaccactgtccgagacaaccttgcactcggagcaccggaagcaacc
gacgaggaaatgacatcgatcctggaacatgttggtttgtcagagtgggttcaaggttta
cccgatggtcttggcactgtccttgattcaggtgccgatagtctctcgggaggtcagcgc
cgccgcctgctccttgcccgcgtactactaagtgatgcaccaattctgcttttggatgaa
cccaccgagcacctcgacactgcaggctcctctgaaatcttgtctatgctggcctccgat
gaactccctggtaaaagagctaggagaaccgtagtgattgtgaggcatgtgaggtaa

DBGET integrated database retrieval system