KEGG   Corynebacterium glutamicum ATCC 21831: AR0_14475Help
Entry
AR0_14475         CDS       T03361                                 

Definition
(GenBank) hypothetical protein
Organism
cgj  Corynebacterium glutamicum ATCC 21831
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Usp
Motif
Other DBs
NCBI-ProteinID: AIK89145
UniProt: A0A0S2T8A6
LinkDB All DBs
Position
3060430..3061371
Genome map
AA seq 313 aa AA seqDB search
MKQPLRVLISCRPEENSGGKRSEQNDAVFEFAAWLARTSDINVRGITTFIRPWPSSSISK
LGGKYHKWYKNLDSYYRSRTIKGLKEAGVEKSQWDDDVSVFVDGPSESTLLTHAAEEFEA
DLILLGSDATAPKGRFLASSTADALLHSSPVPLGLVPRGVKLSKKGVTRVNYAFTNESDD
FEQGLRSSAELATNWNVPLRILAFSPTGITSAPTSRSLDISTELSSEWRELTLAMLDRAR
DGVLTDHPNLSVSSETGSGWGWSGAIDALRWKKGDLLCMGSHRTDTLSRVFVGSETMEII
RNSPVPTIIYPGL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccccttcgcgtacttatttcttgtcgacccgaagaaaattcgggtggcaaa
cgtagtgaacaaaatgatgctgtttttgagttcgccgcatggctagctcgtacttcagac
atcaatgttcgtggaatcacaactttcatacgcccttggccgtcttcctccatcagtaag
ctcggaggaaaatatcataagtggtataagaatttagattcttactaccgcagtcgcacg
atcaagggactcaaagaggccggagttgagaagtcccaatgggacgatgatgtttcagtt
tttgtagatggtccttctgaatccacgctgctcacccatgctgctgaagaattcgaagcg
gacctcattctgcttggctctgatgcgaccgcaccaaaaggccgctttctggccagctcc
accgcagatgccctccttcactcctcgcccgtcccactaggacttgtgccgcgaggggtg
aagctttccaaaaagggtgtcacccgcgtcaactacgctttcaccaatgaaagcgatgac
tttgagcaaggtttacgctcttccgcggagctcgccaccaattggaacgttcctcttcgg
atccttgctttttcacccacaggcattacttccgcaccaacgtcgcggagcttggatatt
tccactgagctttcctccgagtggcgtgaactaacgctcgccatgcttgatcgagcccgt
gatggcgtcctcacagaccacccaaacttgagcgtgagcagtgaaaccggttctggctgg
ggttggagcggtgcaattgatgctttgcgatggaagaaaggtgacctgctgtgcatggga
agccatcgcacagacaccctttcacgtgtctttgtcggttcggaaacaatggaaattatc
cgaaactctcctgtaccgaccatcatttatcccggtctttag

DBGET integrated database retrieval system