KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0360Help
Entry
NCgl0360          CDS       T00102                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00020  Citrate cycle (TCA cycle)
cgl00190  Oxidative phosphorylation
cgl00650  Butanoate metabolism
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01120  Microbial metabolism in diverse environments
cgl01130  Biosynthesis of antibiotics
cgl01200  Carbon metabolism
Module
cgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCgl0360 (sdhA)
   00650 Butanoate metabolism
    NCgl0360 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCgl0360 (sdhA)
Enzymes [BR:cgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NCgl0360 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     NCgl0360 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C NAD_binding_8 GIDA AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-GeneID: 1021051
NCBI-ProteinID: NP_599619
UniProt: Q8NTD6
LinkDB All DBs
Position
393495..395516
Genome map
AA seq 673 aa AA seqDB search
MSTHSETTRPEFIHPVSVLPEVSAGTVLDAAEPAGVPTKDMWEYQKDHMNLVSPLNRRKF
RVLVVGTGLSGGAAAAALGELGYDVKAFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGAY
RHVKDTVKGGDYRGRESDCWRLAVESVRVIDHMNAIGAPFAREYGGALATRSFGGVQVSR
TYYTRGQTGQQLQLSTASALQRQIHLGSVEIFTHNEMVDVIVTERNGEKRCEGLIMRNLI
TGELTAHTGHAVILATGGYGNVYHMSTLAKNSNASAIMRAYEAGAYFASPSFIQFHPTGL
PVNSTWQSKTILMSESLRNDGRIWSPKEPNDNRDPNTIPEDERDYFLERRYPAFGNLVPR
DVASRAISQQINAGLGVGPLNNAAYLDFRDATERLGQDTIRERYSNLFTMYEEAIGEDPY
SSPMRIAPTCHFTMGGLWTDFNEMTSLPGLFCAGEASWTYHGANRLGANSLLSASVDGWF
TLPFTIPNYLGPLLGSERLSEDAPEAQAAIARAQARIDRLMGNRPEWVGDNVHGPEYYHR
QLGDILYFSCGVSRNVEDLQDGINKIRALRDDFWKNMRITGSTDEMNQVLEYAARVADYI
DLGELMCVDALDRDESCGAHFRDDHLSEDGEAERDDENWCFVSAWEPGENGTFVRHAEPL
FFESVPLQTRNYK
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcactctgaaaccacccgcccagagttcatccacccagtctcagtcctccca
gaggtctcagctggtacggtccttgacgctgcagagccagcaggcgttcccaccaaagat
atgtgggaataccaaaaagaccacatgaacctggtctccccactgaaccgacgcaagttc
cgtgtcctcgtcgttggcaccggcctgtccggtggtgctgcagcagcagccctcggcgaa
ctcggatacgacgtcaaggcgttcacctaccacgacgcacctcgccgtgcgcactccatt
gctgcacagggtggcgttaactccgcccgcggcaagaaggtagacaacgacggcgcatac
cgccacgtcaaggacaccgtcaagggcggcgactaccgtggtcgcgagtccgactgctgg
cgtctcgccgtcgagtccgtccgcgtcatcgaccacatgaacgccatcggtgcaccattc
gcccgcgaatacggtggcgccttggcaacccgttccttcggtggtgtgcaggtctcccgt
acctactacacccgtggacaaaccggacagcagctgcagctctccaccgcatccgcacta
cagcgccagatccacctcggctccgtagaaatcttcacccataacgaaatggttgacgtc
attgtcaccgaacgtaacggtgaaaagcgctgcgaaggcctgatcatgcgcaacctgatc
accggcgagctcaccgcacacaccggccatgccgttatcctggcaaccggtggctacggc
aacgtgtaccacatgtccaccctggccaagaactccaacgcctcggccatcatgcgtgca
tacgaagccggcgcatacttcgcgtccccatcgttcatccagttccacccaaccggcctg
cctgtgaactccacctggcagtccaagaccattctgatgtccgagtcgctgcgtaacgac
ggccgcatctggtcccctaaggaaccgaacgataaccgcgatccaaacaccatccctgag
gatgagcgcgactacttcctggagcgccgctacccagcattcggtaacctcgtcccacgt
gacgttgcttcccgtgcgatctcccagcagatcaatgctggtctcggtgttggacctctg
aacaacgctgcatacctggacttccgcgacgccaccgagcgcctcggacaggacaccatc
cgcgagcgttactccaacctcttcaccatgtacgaagaggcaattggcgaggacccatac
tccagcccaatgcgtattgcaccgacctgccacttcaccatgggtggcctctggactgac
ttcaacgaaatgacgtcactcccaggtctgttctgcgcaggcgaagcatcctggacctac
cacggtgcaaaccgtctgggcgcaaactccctgctctccgcttccgtcgatggctggttc
accctgccattcaccatccctaactacctcggcccattgcttggctccgagcgtctgtca
gaggatgcaccagaagcacaggcagcgattgcgcgtgcacaggctcgcattgaccgcctc
atgggcaaccgcccagagtgggtcggtgacaacgttcacggacctgagtactaccaccgc
cagcttggcgatatcctgtacttctcctgtggcgtttcccgaaacgtagaagacctccag
gatggcatcaacaagatccgtgccctccgcgatgacttctggaagaacatgcgcatcacc
ggcagcaccgatgagatgaaccaggttctcgaatacgcagcacgcgtagccgactacatc
gacctcggcgaactcatgtgtgtcgacgccctcgaccgcgacgagtcctgtggcgctcac
ttccgcgacgaccacctctccgaagatggcgaagcagaacgtgacgacgaaaactggtgc
ttcgtctccgcatgggaaccaggcgagaacggaaccttcgtccgccacgcagaaccactg
ttcttcgaatccgtcccactgcagacaaggaactacaagtaa

DBGET integrated database retrieval system