KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0361Help
Entry
NCgl0361          CDS       T00102                                 

Gene name
Cgl0372
Definition
(RefSeq) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00020  Citrate cycle (TCA cycle)
cgl00190  Oxidative phosphorylation
cgl00650  Butanoate metabolism
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01120  Microbial metabolism in diverse environments
cgl01130  Biosynthesis of antibiotics
cgl01200  Carbon metabolism
Module
cgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCgl0361 (Cgl0372)
   00650 Butanoate metabolism
    NCgl0361 (Cgl0372)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCgl0361 (Cgl0372)
Enzymes [BR:cgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NCgl0361 (Cgl0372)
    1.3.5.4  fumarate reductase (quinol)
     NCgl0361 (Cgl0372)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4 Fer4_16 Fer4_18 Fer4_15 Fer4_4 Fer4_2 Fer4_6 Fer4_21 Fer4_3 Fer4_22 Fer4_13 Fer2
Motif
Other DBs
NCBI-GeneID: 1021416
NCBI-ProteinID: NP_599620
UniProt: Q8NTD5
LinkDB All DBs
Position
395516..396265
Genome map
AA seq 249 aa AA seqDB search
MKLTLEIWRQAGPTAEGKFETVQVDDAVAQMSILELLDHVNNKFIEEGKEPFAFASDCRE
GICGTCGLLVNGRPHGADQNKPACAQRLVSYKEGDTLKIEPLRSAAYPVIKDMVVDRSAL
DRVMEQGGYVTINAGTAPDADTLHVNHETAELALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLSLLPLGKEERGLRARKMVDEMETNFGHCSLYGECADVCPAGIPLTAVAAVTKERA
RAAFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttacacttgagatctggcgtcaagcaggcccaactgcggaaggcaagttcgaa
accgtccaggttgacgacgccgtcgcgcagatgtccatcctggagctgcttgaccacgta
aacaacaagttcatcgaagaaggcaaagaaccattcgcgttcgcctctgactgccgcgaa
ggcatttgtggtacctgtggtctcctcgtgaacggtcgccctcacggcgccgaccagaac
aagcctgcctgtgcgcagcgcctggtcagctacaaggaaggcgacaccctcaagatcgaa
ccactgcgttccgccgcatacccagtgatcaaggacatggtcgtcgaccgctccgcactg
gaccgtgtcatggaacagggtggctacgtgaccatcaacgcaggtaccgcacctgacgct
gataccctccacgtcaaccacgaaaccgcagaactcgcacttgaccacgcagcctgcatc
ggctgtggcgcatgtgttgctgcctgccctaacggcgcagcacacctgttcaccggcgca
aagcttgttcacctctccctcctcccactgggtaaggaagagcgcggactgcgtgcacgt
aagatggttgatgaaatggaaaccaacttcggacactgctccctctacggcgagtgcgca
gatgtctgccccgcaggcatcccactgaccgctgtggcagctgtcaccaaggaacgtgcg
cgtgcagctttccgaggcaaagacgactag

DBGET integrated database retrieval system