KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl0462Help
Entry
NCgl0462          CDS       T00102                                 

Gene name
Cgl0479
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00250  Alanine, aspartate and glutamate metabolism
cgl00280  Valine, leucine and isoleucine degradation
cgl00410  beta-Alanine metabolism
cgl00640  Propanoate metabolism
cgl00650  Butanoate metabolism
cgl01100  Metabolic pathways
cgl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NCgl0462 (Cgl0479)
   00650 Butanoate metabolism
    NCgl0462 (Cgl0479)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCgl0462 (Cgl0479)
   00280 Valine, leucine and isoleucine degradation
    NCgl0462 (Cgl0479)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCgl0462 (Cgl0479)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cgl01007]
    NCgl0462 (Cgl0479)
Enzymes [BR:cgl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NCgl0462 (Cgl0479)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     NCgl0462 (Cgl0479)
Amino acid related enzymes [BR:cgl01007]
 Aminotransferase (transaminase)
  Class III
   NCgl0462 (Cgl0479)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 DUF1522
Motif
Other DBs
NCBI-GeneID: 1021485
NCBI-ProteinID: NP_599724
UniProt: Q8NT35
LinkDB All DBs
Position
501577..502923
Genome map
AA seq 448 aa AA seqDB search
MEDLSYRIPQSRTVAEQVPGPKSKALDERRQAAVARALAPGLPGYVVDADGGILADADGN
RFIDLASGIAVTTVGGSNAAVAKAVGAAAARFTHTCFMVSPYETYVAMAERLNALTPGDH
DKKSALFNSGAEAVENAVKVARAYTGKGAVVVFDNAYHGRTNLTMAMTAKNRPYKSGFGP
LAADVYRAPMSYPLRDGLSGPEAAERAISVIESQVGAENLACVVIEPIQGEGGFIVPAPG
FLAAISTWCRENDVVFIADEIQSGFLRTGDWFASDAEGVIPDVITTAKGIAGGMPLSAVT
GRAEIMDAPGPGALGGTYGGNPVACAAALAAIEVMEQADLKTRAQEIETIIRDEFAQLSA
FPEVAEIRGRGAMMAIELIDATGRPNAALTAAVAARAKAEGVLLLTCGTDGNVIRLLPPL
VIAEDTLRDGLQVLVAALERETAHQKVG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatctctcataccgcatcccgcagtcgcgcaccgtggccgagcaggtgccaggg
ccgaagtcgaaagcgctggatgagcgtcgacaagcagcagtagcacgagcacttgcaccg
ggtctgcctggatacgtggtggacgcagacggtggcatcttggctgacgcggacggcaac
cgtttcatcgacctggcctccggcatcgccgtgaccacggtcggcggatccaacgcggcc
gtcgcgaaagccgtcggcgccgcagctgcccgcttcacccacacctgcttcatggtctca
ccttatgaaacttacgtggccatggcggagagactcaacgccttgactccaggcgatcac
gacaagaagagcgcgctgtttaactctggcgccgaagccgtggaaaacgccgtcaaggtg
gcacgcgcctacaccggcaagggcgcggtcgtggtgttcgacaacgcgtaccacggacgg
accaacctcaccatggcgatgaccgcgaagaaccgcccatacaagtccggattcggacca
ctagccgcagacgtctaccgtgcaccaatgtcttacccactgcgcgacggactgtccggc
ccggaagccgcagagcgcgcgatctccgtgatcgaatcccaggtcggagccgaaaacctc
gcctgcgtggtcattgaaccgatccagggcgaaggcggattcatcgtccccgcaccagga
ttcctcgcagccatttccacctggtgccgcgagaacgacgtggtgttcatcgccgatgaa
atccaatctggcttcctgcgcaccggcgactggttcgccagcgacgcagaaggtgtgatc
cccgacgtcatcaccaccgcaaaaggcatcgccggcggcatgccactatccgcagtgacc
ggccgcgcagaaatcatggacgcacccggccccggcgcgctcggcggaacctacggcgga
aaccccgttgcttgcgccgcggcacttgcagccattgaagtgatggaacaagccgacctt
aagacccgcgcgcaagaaatcgagaccatcatccgcgatgaattcgcgcagctgagtgcc
ttcccggaggtcgccgaaatccgcggccgcggagcaatgatggccattgagcttatcgac
gctaccggccgcccgaacgcagctttaaccgccgcagtggctgcgcgcgcaaaagctgaa
ggtgtgctgctgctgacttgcggcaccgatggcaacgtcatccgcctgctgccaccactg
gtcattgcagaggacactctccgtgatggtcttcaggtgttagtcgcagccctagagcgc
gaaaccgcgcaccagaaggtgggctaa

DBGET integrated database retrieval system