KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1523Help
Entry
NCgl1523          CDS       T00102                                 

Gene name
Cgl1585
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00620  Pyruvate metabolism
cgl00680  Methane metabolism
cgl01100  Metabolic pathways
cgl01120  Microbial metabolism in diverse environments
cgl01200  Carbon metabolism
Module
cgl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCgl1523 (Cgl1585)
  09102 Energy metabolism
   00680 Methane metabolism
    NCgl1523 (Cgl1585)
Enzymes [BR:cgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NCgl1523 (Cgl1585)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 1019553
NCBI-ProteinID: NP_600799
UniProt: P12880
LinkDB All DBs
Position
complement(1677384..1680143)
Genome map
AA seq 919 aa AA seqDB search
MTDFLRDDIRFLGQILGEVIAEQEGQEVYELVEQARLTSFDIAKGNAEMDSLVQVFDGIT
PAKATPIARAFSHFALLANLAEDLYDEELREQALDAGDTPPDSTLDATWLKLNEGNVGAE
AVADVLRNAEVAPVLTAHPTETRRRTVFDAQKWITTHMRERHALQSAEPTARTQSKLDEI
EKNIRRRITILWQTALIRVARPRIEDEIEVGLRYYKLSLLEEIPRINRDVAVELRERFGE
GVPLKPVVKPGSWIGGDHDGNPYVTAETVEYSTHRAAETVLKYYARQLHSLEHELSLSDR
MNKVTPQLLALADAGHNDVPSRVDEPYRRAVHGVRGRILATTAELIGEDAVEGVWFKVFT
PYASPEEFLNDALTIDHSLRESKDVLIADDRLSVLISAIESFGFNLYALDLRQNSESYED
VLTELFERAQVTANYRELSEAEKLEVLLKELRSPRPLIPHGSDEYSEVTDRELGIFRTAS
EAVKKFGPRMVPHCIISMASSVTDVLEPMVLLKEFGLIAANGDNPRGTVDVIPLFETIED
LQAGAGILDELWKIDLYRNYLLQRDNVQEVMLGYSDSNKDGGYFSANWALYDAELQLVEL
CRSAGVKLRLFHGRGGTVGRGGGPSYDAILAQPRGAVQGSVRITEQGEIISAKYGNPETA
RRNLEALVSATLEASLLDVSELTDHQRAYDIMSEISELSLKKYASLVHEDQGFIDYFTQS
TPLQEIGSLNIGSRPSSRKQTSSVEDLRAIPWVLSWSQSRVMLPGWFGVGTALEQWIGEG
EQATQRIAELQTLNESWPFFTSVLDNMAQVMSKAELRLAKLYADLIPDTEVAERVYSVIR
EEYFLTKKMFCVITGSDDLLDDNPLLARSVQRRYPYLLPLNVIQVEMMRRYRKGDQSEQV
SRNIQLTMNGLSTALRNSG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgactgattttttacgcgatgacatcaggttcctcggtcaaatcctcggtgaggtaatt
gcggaacaagaaggccaggaggtttatgaactggtcgaacaagcgcgcctgacttctttt
gatatcgccaagggcaacgccgaaatggatagcctggttcaggttttcgacggcattact
ccagccaaggcaacaccgattgctcgcgcattttcccacttcgctctgctggctaacctg
gcggaagacctctacgatgaagagcttcgtgaacaggctctcgatgcaggcgacacccct
ccggacagcactcttgatgccacctggctgaaactcaatgagggcaatgttggcgcagaa
gctgtggccgatgtgctgcgcaatgctgaggtggcgccggttctgactgcgcacccaact
gagactcgccgccgcactgtttttgatgcgcaaaagtggatcaccacccacatgcgtgaa
cgccacgctttgcagtctgcggagcctaccgctcgtacgcaaagcaagttggatgagatc
gagaagaacatccgccgtcgcatcaccattttgtggcagaccgcgttgattcgtgtggcc
cgcccacgtatcgaggacgagatcgaagtagggctgcgctactacaagctgagccttttg
gaagagattccacgtatcaaccgtgatgtggctgttgagcttcgtgagcgtttcggcgag
ggtgttcctttgaagcccgtggtcaagccaggttcctggattggtggagaccacgacggt
aacccttatgtcaccgcggaaacagttgagtattccactcaccgcgctgcggaaaccgtg
ctcaagtactatgcacgccagctgcattccctcgagcatgagctcagcctgtcggaccgc
atgaataaggtcaccccgcagctgcttgcgctggcagatgcagggcacaacgacgtgcca
agccgcgtggatgagccttatcgacgcgccgtccatggcgttcgcggacgtatcctcgcg
acgacggccgagctgatcggcgaggacgccgttgagggcgtgtggttcaaggtctttact
ccatacgcatctccggaagaattcttaaacgatgcgttgaccattgatcattctctgcgt
gaatccaaggacgttctcattgccgatgatcgtttgtctgtgctgatttctgccatcgag
agctttggattcaacctttacgcactggatctgcgccaaaactccgaaagctacgaggac
gtcctcaccgagcttttcgaacgcgcccaagtcaccgcaaactaccgcgagctgtctgaa
gcagagaagcttgaggtgctgctgaaggaactgcgcagccctcgtccgctgatcccgcac
ggttcagatgaatacagcgaggtcaccgaccgcgagctcggcatcttccgcaccgcgtcg
gaggctgttaagaaattcgggccacggatggtgcctcactgcatcatctccatggcatca
tcggtcaccgatgtgctcgagccgatggtgttgctcaaggaattcggactcatcgcagcc
aacggcgacaacccacgcggcaccgtcgatgtcatcccactgttcgaaaccatcgaagat
ctccaggccggcgccggaatcctcgacgaactgtggaaaattgatctctaccgcaactac
ctcctgcagcgcgacaacgtccaggaagtcatgctcggttactccgattccaacaaggat
ggcggatatttctccgcaaactgggcgctttacgacgcggaactgcagctcgtcgaacta
tgccgatcagccggggtcaagcttcgcctgttccacggccgtggtggcaccgtcggccgc
ggtggcggaccttcctacgacgcgattcttgcccagcccaggggggctgtccaaggttcc
gtgcgcatcaccgagcagggcgagatcatctccgctaagtacggcaaccccgaaaccgcg
cgccgaaacctcgaagccctggtctcagccacgcttgaggcatcgcttctcgacgtctcc
gaactcaccgatcaccaacgcgcgtacgacatcatgagtgagatctctgagctcagcttg
aagaagtacgcctccttggtgcacgaggatcaaggcttcatcgattacttcacccagtcc
acgccgctgcaggagattggatccctcaacatcggatccaggccttcctcacgcaagcag
acctcctcggtggaagatttgcgagccatcccatgggtgctcagctggtcacagtctcgt
gtcatgctgccaggctggtttggtgtcggaaccgcattagagcagtggattggcgaaggg
gagcaggccacccaacgcattgccgagctgcaaacactcaatgagtcctggccatttttc
acctcagtgttggataacatggctcaggtgatgtccaaggcagagctgcgtttggcaaag
ctctacgcagacctgatcccagatacggaagtagccgagcgagtctattccgtcatccgc
gaggagtacttcctgaccaagaagatgttctgcgtaatcaccggctctgatgatctgctt
gatgacaacccacttctcgcacgctctgtccagcgccgatacccctacctgcttccactc
aacgtgatccaggtagagatgatgcgacgctaccgaaaaggcgaccaaagcgagcaagtg
tcccgcaacattcagctgaccatgaacggtctttccactgcgctgcgcaactccggctag

DBGET integrated database retrieval system