KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl1560Help
Entry
NCgl1560          CDS       T00102                                 

Gene name
aroK
Definition
(RefSeq) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01130  Biosynthesis of antibiotics
cgl01230  Biosynthesis of amino acids
Module
cgl_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCgl1560 (aroK)
Enzymes [BR:cgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     NCgl1560 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 AAA_17 AAA_16 6PF2K AAA_22 Ploopntkinase3 AAA_5 KTI12 Cytidylate_kin2 AAA_30 CPT MMR_HSR1 AAA_28 NAD_binding_10 Cytidylate_kin CoaE APS_kinase AAA Zeta_toxin Mg_chelatase RuvB_N ABC_tran TsaE RNA_helicase AAA_19
Motif
Other DBs
NCBI-GeneID: 1019591
NCBI-ProteinID: NP_600836
UniProt: Q9X5D1
LinkDB All DBs
Position
complement(1719104..1719676)
Genome map
AA seq 190 aa AA seqDB search
MERNEVNDQIHLDHQSDDTSECSCPIVVLVGLPGAGKSTIGRRLARALNTELVDSDELIE
RATGKACGAVFSELGEPAFRELEAIHVAEALKSSGVVSLGGGSVLTESTRELLKGQDVVW
IDVPVEEGIRRTANERSRPVLQAADPAEHYRNLVKVRTPLYEEVATYRLRTNNRSPQQVV
AAVLHHLEID
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtaatgaagtgaatgatcaaattcacttagatcatcaatcagatgacacctct
gaatgctcctgcccgatcgtggttcttgtgggtttgccaggagctggaaaatccaccatt
ggacgtcgattagcgcgcgccttaaacactgaactcgtcgactccgacgaactgattgag
cgcgccaccggaaaagcctgtggcgccgtgttcagcgagctcggcgagccagccttccgc
gagctcgaggccatccacgtggccgaagcactgaaatcctccggagtggtgagcttggga
ggcggatctgtgctgacagaatccacccgtgaactgctcaaaggccaggacgtggtctgg
atcgacgtgccagtagaagaaggcatcaggcgcaccgcaaacgagcgttcccgccccgtg
ctgcaagccgccgaccccgccgagcactaccgcaacctggtgaaagtgcgcaccccgttg
tacgaagaggtggcaacctaccgacttcgcaccaacaaccgcagcccccagcaagtggtg
gcagcagtgttgcatcatctagaaatcgattaa

DBGET integrated database retrieval system