KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2095Help
Entry
NCgl2095          CDS       T00102                                 

Gene name
Cgl2175
Definition
(RefSeq) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cgl01001]
    NCgl2095 (Cgl2175)
Enzymes [BR:cgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NCgl2095 (Cgl2175)
Protein kinases [BR:cgl01001]
 Serine/threonine kinases: Other
  Bacterial family
   NCgl2095 (Cgl2175)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 1020127
NCBI-ProteinID: NP_601379
UniProt: Q8NNL8
LinkDB All DBs
Position
2302762..2304984
Genome map
AA seq 740 aa AA seqDB search
MANLKVGDVLEDRYRIETPIARGGMSTVYRCLDLRLGRSMALKVMEEDFVDDPIFRQRFR
REARSMAQLNHPNLVNVYDFSATDGLVYLVMELITGGTLRELLAERGPMPPHAAVGVMRG
VLTGLAAAHRAGMVHRDIKPDNVLINSDHQVKLSDFGLVRAAHAGQSQDNQIVGTVAYLS
PEQVEGGEIGPASDVYSAGIVLFELLTGTTPFSGEDDLDHAYARLTEVVPAPSSLIDGVP
SLIDELVATATSINPEDRFDDSGEFLSALEDVATELSLPAFRVPVPVNSAANRANAQVPD
AQPTDMFTTHIPKTPEPDHTAIIPVASANETSILPAQNMAQNMAQNPLQPPEPDFAPEPP
PDTALNIQDQELARADEPEINTVSNRSKLKLTLWSIFVVAVIAAVAVGGWWFGSGRYGEI
PQVLGMDEVQAVAVVEEAGFVAVAEPQYDNEVPTGSIIGTEPSFGERLPRGEDVSVLVSQ
GRPVVPDLSEDRSLSTVREELEQRTFVWVDGPGEYSDDVPEGQVVSFTPSSGTQLDVGET
VQIHLSRGPAPVEIPDVSGMGVDQATRVLERAGLSVERTEEGFDAETPNGDVYGTSPKVS
TEVKRGTSVVLQVSNAISVPDVVGMTKDEATAALAEEGLVVASTSIIPGEAASSADAVVT
VEPESGSRVDPAHPQVSLGLAGEIQVPSVVGRKVSDARSILEEAGLTLTTDADDNDRIYS
QTPRARSEVSVGGEVTVRAF
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacttgaaggtcggtgacgttttagaggacaggtatcggattgaaactccgatt
gcccggggtggtatgtctaccgtgtacaggtgccttgatcttcgtttaggacgttccatg
gcgcttaaagtcatggaagaagatttcgttgatgatcccattttccggcagcgtttccgt
agggaagctcggtcaatggcgcagctaaatcatccaaatttggtcaatgtgtatgatttt
tccgctactgacggtttggtgtatctggtgatggagttaatcactggtggcaccttgcgt
gagttgctggctgagcggggacctatgcccccgcatgctgctgtgggcgttatgcgtggg
gtgctcacgggtctcgcggctgcccaccgggcgggcatggtgcaccgggatatcaagcct
gacaacgtgttgatcaatagtgatcaccaggtgaaactgtctgatttcggcttggttcga
gcggctcacgccggccagtctcaggacaatcagattgtgggcacggtggcttatctttcc
cctgagcaggttgagggcggtgagatcgggccggccagcgacgtgtattcggcaggcatt
gtgctctttgagctgctcacaggcaccacgcctttttcgggcgaggatgatctcgaccat
gcatacgcccgccttacggaagtcgtgccggcaccgagttcgcttatcgacggcgtcccc
tccctcatcgatgagcttgtcgcgacagctacctccattaatcctgaggatcgtttcgat
gattctggagagtttttgtccgcactggaagatgtcgcaacagagttgagcttgccggct
ttccgggtccctgtgccggttaattccgcagccaatagggctaatgcccaggtcccggat
gctcagccaactgatatgtttaccacccatatccccaagactcctgagcctgatcacact
gcgatcattccggtggcctcagcaaatgagacgtcgattctgcctgcgcaaaacatggca
caaaatatggcgcagaatccgctgcaacctccggaacctgatttcgccccggagccacct
ccggacacagcgctgaatattcaagatcaagagcttgcgcgcgccgatgagccagaaatt
aataccgtcagcaatcgttccaaattgaagctgacgttgtggtcaattttcgtggtcgca
gtgatcgctgctgttgctgttggcggttggtggttcggttcaggccgttacggtgagatt
ccgcaggtgttgggcatggatgaggtccaggcagtagctgttgtagaggaagctggtttc
gtggcagtggctgaacctcagtatgacaatgaggttcccactggttcgattattgggact
gaaccttcttttggtgagcgccttcctcgcggcgaggatgtttctgtcctcgtctctcaa
gggcgtcccgtggtgccggatcttagcgaggatcgatccttaagcaccgttcgtgaagag
ttggaacagcgcacgttcgtctgggttgatggcccaggtgaatattctgacgatgttcca
gaaggacaagtagtttcttttacaccgtcgtcaggcacgcagcttgatgttggtgaaacc
gtgcagatccatttgagccgaggccccgccccggttgagattcctgatgtctctggcatg
ggagtggatcaggcaacacgtgtgttggagcgcgcaggtttgagcgtcgagcgtactgaa
gaaggctttgatgctgagacaccaaatggtgatgtctacgggacttcgcccaaggtatct
actgaggtcaagcgcggaacctctgttgtgctgcaggtgtccaatgctatttcggtaccg
gatgtggtgggtatgaccaaggacgaagccaccgcggcgcttgcggaagaaggattggtc
gtggcgtcgacaagcattattcctggtgaggcggcgagctccgctgacgccgtcgtgacc
gtcgagcctgaatccggcagccgcgttgatccagcgcatccgcaggtcagcctcgggtta
gctggggagattcaagttccaagcgtggttggacgtaaggttagcgatgctcgaagcatt
ctggaagaagccggtttaacgctgacaactgatgcggacgacaacgatcgaatttatagt
caaacccctcgtgcacgcagcgaagtctcggtagggggagaagttacagtaagggcgttt
tag

DBGET integrated database retrieval system