KEGG   Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko): NCgl2480
Entry
NCgl2480          CDS       T00102                                 

Gene name
Cgl2569
Definition
(RefSeq) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
cgl  Corynebacterium glutamicum ATCC 13032 (Kyowa Hakko)
Pathway
cgl00020  Citrate cycle (TCA cycle)
cgl00620  Pyruvate metabolism
cgl00650  Butanoate metabolism
cgl01100  Metabolic pathways
cgl01110  Biosynthesis of secondary metabolites
cgl01120  Microbial metabolism in diverse environments
cgl01200  Carbon metabolism
Module
cgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCgl2480 (Cgl2569)
   00620 Pyruvate metabolism
    NCgl2480 (Cgl2569)
   00650 Butanoate metabolism
    NCgl2480 (Cgl2569)
Enzymes [BR:cgl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     NCgl2480 (Cgl2569)
SSDB
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans Phage_rep_org_N
Other DBs
NCBI-GeneID: 1020515
NCBI-ProteinID: NP_601767
UniProt: Q8NMK4
LinkDB
Position
complement(2729376..2730884)
AA seq 502 aa
MSDRIASEKLRSKLMSADEAAQFVNHGDKVGFSGFTGAGYPKALPTAIANRAKEAHGAGN
DYAIDLFTGASTAPDCDGVLAEADAIRWRMPYASDPIMRNKINSGSMGYSDIHLSHSGQQ
VEEGFFGQLNVAVIEITRITEEGYIIPSSSVGNNVEWLNAAEKVILEVNSWQSEDLEGMH
DIWSVPALPNRIAVPINKPGDRIGKTYIEFDTDKVVAVVETNTADRNAPFKPVDDISKKI
AGNFLDFLESEVAAGRLSYDGYIMQSGVGNVPNAVMAGLLESKFENIQAYTEVIQDGMVD
LIDAGKMTVASATSFSLSPEYAEKMNNEAKRYRESIILRPQQISNHPEVIRRVGLIATNG
LIEADIYGNVNSTNVSGSRVMNGIGGSGDFTRNGYISSFITPSEAKGGAISAIVPFASHI
DHTEHDVMVVISEYGYADLRGLAPRERVAKMIGLAHPDYRPLLEEYYARATSGDNKYMQT
PHDLATAFDFHINLAKNGSMKA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgtctgatcgcattgcttcagaaaagctgcgctccaagctcatgtccgccgacgaggcg
gcacagtttgttaaccacggtgacaaggttggtttctccggcttcaccggcgctggctac
ccaaaggcactgcctacggcaatcgctaaccgggctaaagaagcacacggtgcaggcaac
gactacgcaatcgacctgttcactggcgcatcgaccgcccctgactgcgatggcgtactt
gcagaagctgacgctatccgctggcgcatgccatacgcatctgatccaatcatgcgtaac
aagatcaactccggctccatgggatactccgatatccacctgtcccactccggccagcag
gttgaagagggcttcttcggccagctcaacgtagctgtcattgaaatcacccgcatcact
gaagagggctacatcatcccttcttcctccgtgggtaacaacgttgagtggctcaacgct
gcagagaaggtcatcctcgaggttaactcttggcagtctgaagacctcgaaggtatgcac
gacatctggtctgttcctgccctgccaaaccgcattgccgtgccaatcaacaagccaggc
gaccgcatcggtaagacctacatcgagttcgacaccgacaaggttgttgctgttgttgag
accaacaccgcagaccgcaacgcaccattcaagcctgtcgacgacatctctaagaagatc
gctggcaacttcctcgacttcctggaaagcgaagttgctgcaggtcgcctgtcctacgac
ggctacatcatgcagtccggcgtgggcaacgtgccaaacgcggtgatggcaggcctgctg
gaatccaagtttgagaacatccaggcctacaccgaagttatccaggacggcatggtggac
ctcatcgacgccggcaagatgaccgttgcatccgcaacttccttctccctgtctcctgag
tacgcagagaagatgaacaacgaggctaagcgttaccgcgagtccattatcctgcgccca
cagcagatctctaaccacccagaggtcatccgccgcgttggcctgatcgccaccaacggt
ctcatcgaggctgacatttacggcaacgtcaactccaccaacgtttctggctcccgcgtc
atgaacggcatcggcggctccggcgacttcacccgtaacggctacatctccagcttcatc
accccttcagaggcaaagggcggcgcaatctctgcgatcgttcctttcgcatcccacatc
gaccacaccgagcacgatgtcatggttgttatctctgagtacggttacgcagaccttcgt
ggtctggctccacgtgagcgcgttgccaagatgatcggcctggctcaccctgattaccgc
ccactgctcgaggagtactacgctcgcgcaacctccggtgacaacaagtacatgcagacc
cctcatgatcttgcaaccgcgtttgatttccacatcaacctggctaagaacggctccatg
aaggcataa

DBGET integrated database retrieval system