KEGG   Corynebacterium glutamicum MB001: cgp_0104Help
Entry
cgp_0104          CDS       T02791                                 

Gene name
codA
Definition
(GenBank) cytosine deaminase
  KO
K01485  cytosine/creatinine deaminase [EC:3.5.4.1 3.5.4.21]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
cgm00240  Pyrimidine metabolism
cgm00330  Arginine and proline metabolism
cgm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    cgp_0104 (codA)
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    cgp_0104 (codA)
Enzymes [BR:cgm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.1  cytosine deaminase
     cgp_0104 (codA)
    3.5.4.21  creatinine deaminase
     cgp_0104 (codA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_3 Amidohydro_1 DUF2332
Motif
Other DBs
NCBI-ProteinID: AGT04086
LinkDB All DBs
Position
complement(83667..84938)
Genome map
AA seq 423 aa AA seqDB search
MTCRNGVLVRITNAQVKNYAELVDITIEGEKISSITPSSIRSEEDHRADDYDAAGRLVAP
QFAEAHIHLDYANTAGIPRENSSGTLFEAIEIWADRKTQGFHIKEDIKAKALQAARRAAE
HGVGFIRTHVDVTDPTFAGFEAIAELRDEVREWCDIQIVAFPQNGIYAYEGGQKLISDAM
SAGADVVGGIPHLEPTRDDGVESVKWLFDLAEKHSAPIDIHTDEIDDPHSRFVEVLAAEA
AKRDMGAQTVVSHSVAMAYYSPGYMARLLPKLAASKVRFAVCPNENLHLQGLGFQGPVPR
GVAPVKQLTEWGIPVSFCQDSLNDPFYPMGDGDLLRILDSGLHVSHMLTASHLKNALSFI
TTNPAGNLGLDNYDIAENSPANLLVLDASSEKEAVQRKASVLLSIHRGKKVLSREPEQVD
WNI
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgacatgtagaaatggagttcttgtgcgcattacaaacgcccaggttaagaactacgca
gagttagttgatatcaccatagagggtgaaaaaatttcctcgattaccccctcttcaatt
cgatcagaagaagatcaccgcgcggacgattacgatgccgcaggaagactggtcgcaccc
cagttcgccgaagcacacatccaccttgactacgcaaacaccgctggaatccctcgcgaa
aactcttccggcacactttttgaagccatcgaaatctgggccgaccgcaagacccaaggc
ttccacatcaaagaagacattaaagcgaaggccctccaggcagcccgtcgggcagcagaa
cacggcgttggtttcatccgcactcacgtagatgtcaccgatcccacgtttgctggattc
gaagcaattgcggagctgcgcgatgaagtccgcgagtggtgcgatatccagattgtcgcc
ttcccgcaaaatggcatttacgcctacgaaggtggccagaagctaatctcagatgcaatg
tctgcaggtgcagatgtcgttggtggcatcccacaccttgaacccacccgagacgatggc
gtcgagtcggtgaaatggctgttcgaccttgcagagaagcactcagcccccatcgatatc
cacactgatgaaattgacgatccacattcccgatttgtcgaagtcctcgccgcagaagcc
gcaaaacgtgacatgggcgcacaaaccgtggtgtctcattctgtggcgatggcctattac
tcacctggctacatggcgcgacttttacccaagctcgcagcatcaaaggttcgttttgca
gtatgccccaatgaaaacctccatctgcaaggacttggtttccaaggacccgtcccccga
ggtgttgcaccggtaaagcaacttaccgaatggggaattccagtaagtttttgccaggac
tcactcaatgaccccttctaccccatgggcgatggagatctactccgcattctcgattct
ggattacacgtgtcccacatgctcacagccagccacttgaagaatgcactatcgttcatc
accaccaatccagccggaaacctaggcctggacaattacgacattgcagaaaactccccg
gcgaacctgctggttcttgatgcgagcagcgagaaggaagctgtacagagaaaagcttcc
gtacttttgagcatccaccgcggcaaaaaggtgctctccagggagcccgaacaggtggac
tggaacatctaa

DBGET integrated database retrieval system