KEGG   Corynebacterium glutamicum MB001: cgp_1493Help
Entry
cgp_1493          CDS       T02791                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
cgm00473  D-Alanine metabolism
cgm00550  Peptidoglycan biosynthesis
cgm01100  Metabolic pathways
cgm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cgm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    cgp_1493 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    cgp_1493 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    cgp_1493 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cgm01011]
    cgp_1493 (ddlA)
Enzymes [BR:cgm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     cgp_1493 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:cgm01011]
 Precursor biosynthesis
  Amino acid ligase
   cgp_1493 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATPgrasp_ST CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AGT05306
LinkDB All DBs
Position
1388050..1389132
Genome map
AA seq 360 aa AA seqDB search
MSNSNSGKVRVAVVYGGRSSEHSVSCVSAGAIMAHLDPEKYDVIPVGITVDGAWVVGETD
PQKLTLIDRTMPEVEHHEEVRPSLDPAHRGEFHFSDGSLYATADVIFPVLHGRFGEDGTV
QGLFALSDIPVVGPGVLASAAGMDKEYTKKLMAAEGLPVGREVILRDRTELTEAEKNLLG
LPVFVKPARGGSSIGISRVTAWEDFNKAVGLARAHDEKVIVESEIVGSEVECGVLQYPDG
RIVASVPALLSGTESGAGGFYDFDTKYLDNVVTAEIPAPLDEKTTELIQSLAVESFQALA
CEGLARVDFFVTANGPVLNEINTMPGFTPISMYPQMFTASGVAYEELLDVLVQQALHRDN
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaactctaattctggaaaagtccgcgtcgcagtcgtttatggtggtcgcagttct
gagcactccgtctcctgcgtctccgctggtgctatcatggcccatctcgatcctgagaag
tacgatgtgattcccgtcggcattactgtcgacggcgcgtgggttgttggtgaaaccgat
ccacagaagctaactctcatcgatcgcaccatgcctgaggtggagcatcatgaagaggtt
cgcccaagcctggatcccgcacaccgtggagagttccacttttccgatggcagcttgtat
gccaccgctgatgtgattttccctgtgctgcatggtcgttttggtgaagacggcactgtg
cagggtctgtttgcactgtctgatattccggtcgttggcccaggtgtgctggcctctgct
gcgggaatggacaaggaatacactaagaagctcatggcagcggaagggctgcccgttggc
cgtgaggtgattctacgtgatcgtaccgagctgaccgaggcagaaaagaacctgctgggc
ctgcctgtatttgtgaagcctgcgcgtggtggctcatcgattggtatctctcgtgttact
gcgtgggaggattttaataaggctgtggggcttgctcgtgcccatgatgagaaggtcatt
gtggaatcagagatcgttggctctgaggtggagtgtggcgtgctgcagtatccagacggt
cgtatcgtggcgtctgttcctgcgttgctgtctggcaccgaatcaggcgctggtggattc
tatgactttgataccaagtacttggacaacgttgttactgcagagatcccagcaccgctt
gatgagaagaccacggaactgatccagtctttggctgtggaatctttccaggctcttgcg
tgtgaaggccttgctcgcgtggacttctttgttaccgccaatggtcctgtgctcaatgag
atcaacaccatgccaggatttacccccatttccatgtacccacagatgttcactgcatca
ggcgtggcttatgaggaattgttggatgtgttggtgcagcaggcattgcaccgcgacaac
tag

DBGET integrated database retrieval system