KEGG   Chryseobacterium gallinarum: OK18_00335Help
Entry
OK18_00335        CDS       T03954                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cgn  Chryseobacterium gallinarum
Pathway
cgn03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cgn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    OK18_00335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cgn03400]
    OK18_00335
Enzymes [BR:cgn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     OK18_00335
DNA repair and recombination proteins [BR:cgn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     OK18_00335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AKK71290
UniProt: A0A0G3LY28
LinkDB All DBs
Position
complement(70872..73571)
Genome map
AA seq 899 aa AA seqDB search
MGLSKYREKRSEENTPEPFGGKPTGTELRFVVQKHDASHLHYDFRLEMDGVLKSWAVPKG
PSMDPSVKRLAMMVEDHPYDYRNFEGIIPKGQYGGGTVIVWDEGTYEPAEGNLKDVSKQE
KELLHQLYSGKLKFKLNGKKLKGEFALVKAHGRGDNGWLLMKLDDKYASEKDITAKDKSV
ISGKTIPQMEKSPDKVYGENIIKKDSTVKDKRSTKKKAAELINDQLEAVPSDSPKNKANI
QSLLKKAPKQRFYTHIEPMLATLVNKPFDDEEWVYEVKWDGYRAVAFMHKGEVELKSRND
KSFNEKFYPIYDTLKALEFDAILDGEVVVLGESGTANFGSLQNWRSEADGDLVYYVFDIL
WYQGHDLTELTLLERKAILREILPKNNSILVSEHFETSGIQFLEEARKLGLEGIMAKRKE
SRYHTHNRSKDWLKIKANKRQEVVIGGYTLNDDSSKLFSSILVGVYEGKKLIYTGKVGTG
FNDKMQKEMMKLFKPLITDKVPFSEEPDVNKPSRFRPNPPHAAVTWLKPELVCEVSCTEL
TSDGIMRHPSFDGMREDKSARKVVLEEEAPTEKLVEEGADRIVTPGAKGQRKTLLNPKDK
TQVRKINRHELKFSNLDKVFWSKEGITKRDLINYYYQAAPFILPYLKGRPQSMNRFPNGI
EGEGFYFKNVTDTAPEWAETYLYQSDADDKDRHYLVGKDEATLLYMANLGCIEMNPWSST
VKKPEHPSFCIIDLDPDQNSFDQVIEAALVTKSILDDMGVPSYCKTSGSTGLHIYIPLGG
KYTYEQSKEFARVIVTLVHNELPRFTSIERAIKDRKGKMYLDFLQNRPHATIAAAYSVRP
KPGATVSMPLHWDEVKEGLKISDFHILNAIERMQSEGDIFKPVLGKGIDLKSIVDKHAH
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgggcttatctaaatatcgtgagaagcgttcagaggagaacaccccggaaccttttggc
ggaaaaccaacaggaacagaacttcgttttgtggtacaaaagcacgatgcttcccatttg
cattatgattttcgccttgaaatggacggggtactgaaaagctgggcggttcctaagggg
ccttcgatggaccccagtgtgaaacgtcttgcgatgatggtcgaggatcatccctatgat
taccggaattttgaagggatcatacccaaaggtcaatatggaggcggaacggtgattgtg
tgggacgaagggacttacgaaccagctgaaggtaacctgaaggatgtatcgaaacaggaa
aaagaacttttacaccagctctattccggcaagcttaaatttaagctcaacggcaaaaag
cttaaaggtgaatttgcactggtgaaggcccacggaaggggagataacggctggctcctg
atgaaacttgacgataaatacgccagtgaaaaagatattacggccaaagataagtcggtg
atctcgggtaaaaccattccacagatggaaaaatcgcctgataaagtttatggcgaaaat
attatcaaaaaggacagcaccgtaaaagacaagcgttcaacaaaaaagaaagcagcagaa
cttatcaatgaccagctggaagcagttccttcggatagtccgaaaaacaaagcaaacata
cagtccttactaaaaaaggcgccgaaacaacggttctatacccatatcgaacccatgctt
gctacactggtcaataaaccctttgacgatgaagaatgggtttacgaggtaaagtgggat
ggctaccgggctgttgcttttatgcataaaggtgaagtggaactgaaatcccgtaacgac
aagagcttcaatgagaaattctatccgatctatgatactttgaaagccttggaatttgac
gccatactggacggcgaggtggttgtgctgggagaaagcggtaccgccaatttcggctcc
ctacagaactggcgcagtgaagccgatggcgatctggtctactatgtttttgatatcctg
tggtatcagggacacgatctcacagagctgactcttctggaacgtaaagctattttaaga
gaaattctccctaaaaataacagcattctggtcagcgagcattttgaaacatccggtata
caatttctagaggaagccagaaagctgggactggaagggatcatggccaagcgaaaggag
agcagataccatacacacaaccggtccaaagactggttaaagatcaaagccaataagcga
caggaagttgtgatcggaggatatacgcttaacgatgattccagtaaattattcagcagt
attctggtaggcgtttatgaagggaagaaactgatctataccggtaaagtcggtacaggc
ttcaacgataaaatgcagaaggaaatgatgaaacttttcaaaccgcttatcaccgataaa
gtacctttctccgaagaaccggacgtcaataagccttcacgttttcggccaaatccgcca
catgcagcggtcacctggctgaaacccgagcttgtctgtgaggtgagctgcacggagctg
accagcgacgggatcatgcggcatccttcgttcgatggcatgcgggaggataaaagcgcc
agaaaagttgttctggaagaagaggcaccgactgaaaagctggtagaagaaggggcagac
cgtattgttacgccaggtgcgaaaggacaacggaaaaccctgttaaacccaaaagataag
acgcaggtgcggaaaataaaccgtcatgaattaaagtttagcaatctggataaggtcttc
tggtcaaaagaaggcatcaccaaacgtgacctcatcaattactattatcaggctgctccc
tttatattgccatacttaaaaggccgtccgcagagcatgaaccgttttcccaatggaatc
gaaggcgaaggtttttactttaagaatgtaactgatactgctcccgaatgggcagaaacg
tacctgtatcaaagtgatgctgatgataaagaccgtcattaccttgtgggaaaagatgaa
gcaacgcttctttacatggctaatctgggttgtatagaaatgaacccctggagcagcacc
gttaaaaagccggagcatccgagcttctgtatcatcgatcttgaccccgatcaaaattca
ttcgatcaagtgatcgaagccgccctggttaccaagagcatactcgatgatatgggcgta
ccgagctactgtaaaaccagcggttctacaggactacacatttatattccccttggcgga
aaatatacttacgagcagtcgaaagagtttgcccgggtcattgttacccttgtccataat
gagcttcccagatttaccagtatagaacgagctatcaaagaccggaagggaaagatgtat
cttgattttttacagaacaggccccatgctaccattgcagctgcatattccgtcaggccg
aaaccgggagccactgtatcaatgccgctccattgggatgaggtcaaagaaggcttgaaa
ataagcgattttcacatcctgaatgccattgaaagaatgcagagtgagggagatattttc
aagcccgttctaggaaaaggaatcgacttaaaatctatagttgacaaacatgctcattaa

DBGET integrated database retrieval system